BLASTX nr result
ID: Catharanthus23_contig00026032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00026032 (201 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006353066.1| PREDICTED: probable RNA 3'-terminal phosphat... 55 7e-06 ref|XP_004233207.1| PREDICTED: probable RNA 3'-terminal phosphat... 55 7e-06 >ref|XP_006353066.1| PREDICTED: probable RNA 3'-terminal phosphate cyclase-like protein-like isoform X1 [Solanum tuberosum] gi|565372988|ref|XP_006353067.1| PREDICTED: probable RNA 3'-terminal phosphate cyclase-like protein-like isoform X2 [Solanum tuberosum] Length = 378 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -2 Query: 200 GLRSLEVSFLRLLEKVCDDCVFEIKETGN*LSYKCCFLM 84 GLR EVSFLRLLEKVCDDCV EI ETG L YK +M Sbjct: 42 GLRPHEVSFLRLLEKVCDDCVVEINETGTKLKYKPGIIM 80 >ref|XP_004233207.1| PREDICTED: probable RNA 3'-terminal phosphate cyclase-like protein-like [Solanum lycopersicum] Length = 378 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = -2 Query: 200 GLRSLEVSFLRLLEKVCDDCVFEIKETGN*LSYKCCFLM 84 GLR EVSFLRLLEKVCDDCV EI ETG L YK +M Sbjct: 42 GLRPHEVSFLRLLEKVCDDCVVEINETGTKLKYKPGIIM 80