BLASTX nr result
ID: Catharanthus23_contig00025991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00025991 (442 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280220.1| PREDICTED: putative glucose-6-phosphate 1-ep... 74 2e-11 emb|CAN81195.1| hypothetical protein VITISV_022854 [Vitis vinifera] 74 2e-11 gb|EXC22512.1| Putative glucose-6-phosphate 1-epimerase [Morus n... 71 1e-10 ref|XP_002511956.1| aldose 1-epimerase, putative [Ricinus commun... 71 2e-10 ref|XP_002301394.1| aldose 1-epimerase family protein [Populus t... 70 3e-10 ref|XP_006339669.1| PREDICTED: putative glucose-6-phosphate 1-ep... 69 6e-10 ref|XP_004494784.1| PREDICTED: putative glucose-6-phosphate 1-ep... 69 6e-10 ref|XP_002876625.1| aldose 1-epimerase family protein [Arabidops... 69 6e-10 ref|XP_002867798.1| hypothetical protein ARALYDRAFT_914430 [Arab... 69 6e-10 ref|XP_006402464.1| hypothetical protein EUTSA_v10006104mg [Eutr... 69 8e-10 ref|XP_004229975.1| PREDICTED: putative glucose-6-phosphate 1-ep... 69 8e-10 ref|XP_003608337.1| hypothetical protein MTR_4g092780 [Medicago ... 69 8e-10 ref|XP_006291512.1| hypothetical protein CARUB_v10017661mg [Caps... 67 2e-09 ref|XP_004133830.1| PREDICTED: putative glucose-6-phosphate 1-ep... 67 2e-09 gb|ADN34167.1| aldose 1-epimerase [Cucumis melo subsp. melo] 67 2e-09 ref|XP_004306701.1| PREDICTED: putative glucose-6-phosphate 1-ep... 66 5e-09 ref|NP_191720.1| galactose mutarotase-like superfamily protein [... 66 5e-09 gb|ESW19264.1| hypothetical protein PHAVU_006G109800g [Phaseolus... 65 7e-09 gb|AHA84248.1| glucose-6-phosphate 1-epimerase [Phaseolus vulgaris] 65 7e-09 gb|EOX95795.1| Galactose mutarotase-like superfamily protein [Th... 65 9e-09 >ref|XP_002280220.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Vitis vinifera] gi|297745389|emb|CBI40469.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++AIE+TKDWNG DQVVLRNPQGASARVSLH Sbjct: 1 MGHSAAVWDHRTAIEVTKDWNGIDQVVLRNPQGASARVSLH 41 >emb|CAN81195.1| hypothetical protein VITISV_022854 [Vitis vinifera] Length = 364 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++AIE+TKDWNG DQVVLRNPQGASARVSLH Sbjct: 1 MGHSAAVWDHRTAIEVTKDWNGIDQVVLRNPQGASARVSLH 41 >gb|EXC22512.1| Putative glucose-6-phosphate 1-epimerase [Morus notabilis] Length = 312 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD K+A E+TKDWNG DQVVLR+PQGASARVSLH Sbjct: 1 MGHSAAVWDYKAATEITKDWNGIDQVVLRSPQGASARVSLH 41 >ref|XP_002511956.1| aldose 1-epimerase, putative [Ricinus communis] gi|223549136|gb|EEF50625.1| aldose 1-epimerase, putative [Ricinus communis] Length = 317 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++AIE+ KDWNG DQVVLRNP+GASARVSLH Sbjct: 1 MGHSAAVWDHRAAIEIAKDWNGIDQVVLRNPRGASARVSLH 41 >ref|XP_002301394.1| aldose 1-epimerase family protein [Populus trichocarpa] gi|118487620|gb|ABK95635.1| unknown [Populus trichocarpa] gi|222843120|gb|EEE80667.1| aldose 1-epimerase family protein [Populus trichocarpa] Length = 317 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 M H + VWD ++AIE TKDWNG DQVVLRNPQGASARVSLH Sbjct: 1 MRHSAAVWDYRAAIEHTKDWNGMDQVVLRNPQGASARVSLH 41 >ref|XP_006339669.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Solanum tuberosum] Length = 308 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSL 4 MGH++ VWD +A E+TKDWNG +QVVLRNPQGASARVSL Sbjct: 1 MGHYAAVWDHTAATELTKDWNGIEQVVLRNPQGASARVSL 40 >ref|XP_004494784.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform X1 [Cicer arietinum] gi|502113867|ref|XP_004494785.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform X2 [Cicer arietinum] gi|502113870|ref|XP_004494786.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform X3 [Cicer arietinum] gi|502113873|ref|XP_004494787.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform X4 [Cicer arietinum] gi|502113876|ref|XP_004494788.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform X5 [Cicer arietinum] Length = 317 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++A E+TKDWNG DQVVLR PQGASARVSLH Sbjct: 1 MGHSAAVWDFRAATEITKDWNGIDQVVLRTPQGASARVSLH 41 >ref|XP_002876625.1| aldose 1-epimerase family protein [Arabidopsis lyrata subsp. lyrata] gi|297322463|gb|EFH52884.1| aldose 1-epimerase family protein [Arabidopsis lyrata subsp. lyrata] Length = 317 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH++ VWDQK A E+ KDWNG DQV+LRNP GASA++SLH Sbjct: 1 MGHYATVWDQKEASEIIKDWNGVDQVLLRNPHGASAKISLH 41 >ref|XP_002867798.1| hypothetical protein ARALYDRAFT_914430 [Arabidopsis lyrata subsp. lyrata] gi|297804760|ref|XP_002870264.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313634|gb|EFH44057.1| hypothetical protein ARALYDRAFT_914430 [Arabidopsis lyrata subsp. lyrata] gi|297316100|gb|EFH46523.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 82 Score = 68.9 bits (167), Expect = 6e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH++ VWDQK A E+ KDWNG DQV+LRNP GASA++SLH Sbjct: 1 MGHYATVWDQKEASEIIKDWNGVDQVLLRNPHGASAKISLH 41 >ref|XP_006402464.1| hypothetical protein EUTSA_v10006104mg [Eutrema salsugineum] gi|557103563|gb|ESQ43917.1| hypothetical protein EUTSA_v10006104mg [Eutrema salsugineum] Length = 317 Score = 68.6 bits (166), Expect = 8e-10 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH++ VWD K+A E+ KDWNG DQV+LRNP GASA++SLH Sbjct: 1 MGHYAAVWDHKAATEIIKDWNGIDQVLLRNPHGASAKISLH 41 >ref|XP_004229975.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform 1 [Solanum lycopersicum] gi|460368241|ref|XP_004229976.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform 2 [Solanum lycopersicum] Length = 308 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSL 4 MGH++ VWD +A E+TKDWNG +QVVLRNPQGASARVSL Sbjct: 1 MGHYAAVWDHTAATEVTKDWNGIEQVVLRNPQGASARVSL 40 >ref|XP_003608337.1| hypothetical protein MTR_4g092780 [Medicago truncatula] gi|355509392|gb|AES90534.1| hypothetical protein MTR_4g092780 [Medicago truncatula] Length = 317 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++A E TKDWNG DQVVLR PQGASARVSLH Sbjct: 1 MGHSAAVWDFRAATEFTKDWNGIDQVVLRTPQGASARVSLH 41 >ref|XP_006291512.1| hypothetical protein CARUB_v10017661mg [Capsella rubella] gi|482560219|gb|EOA24410.1| hypothetical protein CARUB_v10017661mg [Capsella rubella] Length = 317 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWDQK A E+ KDWNG DQV+LRNP GASA++SLH Sbjct: 1 MGHCATVWDQKEATEIIKDWNGIDQVLLRNPHGASAKISLH 41 >ref|XP_004133830.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Cucumis sativus] gi|449480272|ref|XP_004155847.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Cucumis sativus] Length = 309 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++A E+T+DWNG DQVVLRNP+GASAR+SLH Sbjct: 1 MGHSAPVWDCRAATEITQDWNGIDQVVLRNPKGASARISLH 41 >gb|ADN34167.1| aldose 1-epimerase [Cucumis melo subsp. melo] Length = 309 Score = 67.0 bits (162), Expect = 2e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++A E+T+DWNG DQVVLRNP+GASAR+SLH Sbjct: 1 MGHSAPVWDCRAATEITQDWNGIDQVVLRNPKGASARISLH 41 >ref|XP_004306701.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Fragaria vesca subsp. vesca] Length = 317 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH S VWD K+A+E+TKD NG QVVLRNPQGASA+VSLH Sbjct: 1 MGHSSAVWDCKAAVEITKDLNGVGQVVLRNPQGASAQVSLH 41 >ref|NP_191720.1| galactose mutarotase-like superfamily protein [Arabidopsis thaliana] gi|6850852|emb|CAB71091.1| putative protein [Arabidopsis thaliana] gi|332646710|gb|AEE80231.1| galactose mutarotase-like superfamily protein [Arabidopsis thaliana] Length = 317 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MG ++ VWDQK A E+ KDWNG DQV+LRNP GASA++SLH Sbjct: 1 MGQYATVWDQKEASEIIKDWNGVDQVLLRNPHGASAKISLH 41 >gb|ESW19264.1| hypothetical protein PHAVU_006G109800g [Phaseolus vulgaris] Length = 317 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++A E+TKDWNG DQ++LR P+G+SARVSLH Sbjct: 1 MGHSAAVWDYRAATEITKDWNGIDQILLRTPRGSSARVSLH 41 >gb|AHA84248.1| glucose-6-phosphate 1-epimerase [Phaseolus vulgaris] Length = 318 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++A E+TKDWNG DQ++LR P+G+SARVSLH Sbjct: 1 MGHSAAVWDYRAATEITKDWNGIDQILLRTPRGSSARVSLH 41 >gb|EOX95795.1| Galactose mutarotase-like superfamily protein [Theobroma cacao] Length = 317 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 123 MGHFSGVWDQKSAIEMTKDWNGHDQVVLRNPQGASARVSLH 1 MGH + VWD ++A E++KDWNG D+VVLRNP+GASA VSLH Sbjct: 1 MGHSAAVWDYRAATEISKDWNGIDKVVLRNPRGASASVSLH 41