BLASTX nr result
ID: Catharanthus23_contig00025886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00025886 (413 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519280.1| ubiquitin-protein ligase, putative [Ricinus ... 56 6e-06 >ref|XP_002519280.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223541595|gb|EEF43144.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 1067 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 413 RGAGNASEVALDQLPTEATCTNLLKLPPYRRL 318 R AG+ASE ALD+LPT ATC NLLKLPPYRRL Sbjct: 983 RAAGSASEEALDRLPTSATCMNLLKLPPYRRL 1014