BLASTX nr result
ID: Catharanthus23_contig00025884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00025884 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY28223.1| Basic helix-loop-helix DNA-binding superfamily pr... 61 2e-07 >gb|EOY28223.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma cacao] Length = 226 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/51 (60%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -3 Query: 319 LHEERAEIVRANYSVKDNTVFHIIHSKIAE-FEAYYGSAARVSERLRKIVD 170 LHEE AEIV A++SV D+TVFH IH +AE + YG+AAR+SERL+K V+ Sbjct: 171 LHEEGAEIVNASFSVVDDTVFHTIHLTVAESYAPDYGAAARISERLQKFVN 221