BLASTX nr result
ID: Catharanthus23_contig00025687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00025687 (506 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC34486.1| hypothetical protein L484_019083 [Morus notabilis] 56 4e-06 ref|XP_004296194.1| PREDICTED: uncharacterized protein LOC101291... 56 4e-06 gb|EMJ07863.1| hypothetical protein PRUPE_ppa022765mg [Prunus pe... 56 4e-06 ref|XP_004142172.1| PREDICTED: uncharacterized protein LOC101218... 56 4e-06 ref|XP_006354139.1| PREDICTED: uncharacterized protein LOC102600... 56 6e-06 ref|XP_004228981.1| PREDICTED: uncharacterized protein LOC101246... 56 6e-06 ref|XP_004228615.1| PREDICTED: uncharacterized protein LOC101245... 56 6e-06 ref|XP_002304863.2| hypothetical protein POPTR_0003s21220g [Popu... 55 1e-05 >gb|EXC34486.1| hypothetical protein L484_019083 [Morus notabilis] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 505 IDPRRYCGHNLHFYYVKWLH-*SKEPFFYW 419 IDPR GHNLHFYYVKWLH S+EPFFYW Sbjct: 222 IDPRHRYGHNLHFYYVKWLHCQSREPFFYW 251 >ref|XP_004296194.1| PREDICTED: uncharacterized protein LOC101291616 [Fragaria vesca subsp. vesca] Length = 663 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 505 IDPRRYCGHNLHFYYVKWLH-*SKEPFFYW 419 IDPR GHNLHFYYVKWLH S+EPFFYW Sbjct: 226 IDPRHRYGHNLHFYYVKWLHCQSREPFFYW 255 >gb|EMJ07863.1| hypothetical protein PRUPE_ppa022765mg [Prunus persica] Length = 674 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 505 IDPRRYCGHNLHFYYVKWLH-*SKEPFFYW 419 IDPR GHNLHFYYVKWLH S+EPFFYW Sbjct: 231 IDPRHRYGHNLHFYYVKWLHCQSREPFFYW 260 >ref|XP_004142172.1| PREDICTED: uncharacterized protein LOC101218379 [Cucumis sativus] gi|449521914|ref|XP_004167974.1| PREDICTED: uncharacterized protein LOC101230380 [Cucumis sativus] Length = 615 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 505 IDPRRYCGHNLHFYYVKWLH-*SKEPFFYW 419 IDPR GHNLHFYY+KWLH SKEPFFYW Sbjct: 217 IDPRHRYGHNLHFYYMKWLHSQSKEPFFYW 246 >ref|XP_006354139.1| PREDICTED: uncharacterized protein LOC102600172 [Solanum tuberosum] Length = 632 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 505 IDPRRYCGHNLHFYYVKWLH-*SKEPFFYW 419 IDPR GHNLHFYYV+WLH SKEPFFYW Sbjct: 206 IDPRHRYGHNLHFYYVQWLHSQSKEPFFYW 235 >ref|XP_004228981.1| PREDICTED: uncharacterized protein LOC101246855 [Solanum lycopersicum] Length = 567 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 505 IDPRRYCGHNLHFYYVKWLH-*SKEPFFYW 419 IDPR GHNLHFYYV+WLH SKEPFFYW Sbjct: 194 IDPRHRYGHNLHFYYVQWLHSQSKEPFFYW 223 >ref|XP_004228615.1| PREDICTED: uncharacterized protein LOC101245483 [Solanum lycopersicum] Length = 632 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 505 IDPRRYCGHNLHFYYVKWLH-*SKEPFFYW 419 IDPR GHNLHFYYV+WLH SKEPFFYW Sbjct: 206 IDPRHRYGHNLHFYYVQWLHSQSKEPFFYW 235 >ref|XP_002304863.2| hypothetical protein POPTR_0003s21220g [Populus trichocarpa] gi|550343689|gb|EEE79842.2| hypothetical protein POPTR_0003s21220g [Populus trichocarpa] Length = 499 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/30 (76%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = -2 Query: 505 IDPRRYCGHNLHFYYVKWLH-*SKEPFFYW 419 IDPR GHNLHFYY+KWLH S+EPFFYW Sbjct: 221 IDPRHRYGHNLHFYYLKWLHSKSREPFFYW 250