BLASTX nr result
ID: Catharanthus23_contig00024468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00024468 (629 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF97638.1| ribulose-1,5-bisphosphate carboxylase/oxygenase l... 56 7e-06 >gb|AAF97638.1| ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Apodolirion lanceolatum] Length = 231 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +3 Query: 159 YKTKDIDILAAFRVTPQPEFHPKSSGCGSC*IYYW 263 Y+TKD DILAAFRVTPQP + GCGSC I+YW Sbjct: 16 YETKDTDILAAFRVTPQPGVPAEKQGCGSCRIFYW 50