BLASTX nr result
ID: Catharanthus23_contig00024334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00024334 (288 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA40555.1| TNP2 [Antirrhinum majus] 44 3e-07 >emb|CAA40555.1| TNP2 [Antirrhinum majus] Length = 752 Score = 43.5 bits (101), Expect(2) = 3e-07 Identities = 20/46 (43%), Positives = 30/46 (65%) Frame = -3 Query: 139 DMDGLVHDAFGILRIEIGGENNMGTRDQMPNKEAERFYKIINDSEQ 2 DM LVHDAFG+ I E ++ PN+EA+ FYK+++D++Q Sbjct: 99 DMHNLVHDAFGVEDDNINSEEEPNEEEE-PNEEAKTFYKLLDDAQQ 143 Score = 36.6 bits (83), Expect(2) = 3e-07 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 287 EHLIVRGFIRGYIHWVKHEE 228 EHLI+ GFI+GY HWV H E Sbjct: 61 EHLIIDGFIKGYTHWVIHGE 80