BLASTX nr result
ID: Catharanthus23_contig00024276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00024276 (912 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74236.1| hypothetical protein VITISV_004916 [Vitis vinifera] 58 4e-06 >emb|CAN74236.1| hypothetical protein VITISV_004916 [Vitis vinifera] Length = 849 Score = 58.2 bits (139), Expect = 4e-06 Identities = 30/98 (30%), Positives = 57/98 (58%) Frame = -2 Query: 344 VKFVLYVIGKSIHPMMRSAVKRIWLPILKNIDAVKEMNWPKFFIDKLLARIKKKLTQSRS 165 V+FVL+V+G + P M+ V R +L ++++ID++K+MNW +F + L+ I++ + +S Sbjct: 388 VRFVLFVLGALLCPTMKLFVNRSFLHLVEDIDSIKKMNWXEFVLSYLVHGIEEFKKKQQS 447 Query: 164 SVSG*IILVDTLFLERFSLVREWVVPMEKHGIPRLCEW 51 V G ++ + + E S E +P+ PR+ W Sbjct: 448 GVCGCLLFLMLFYHEHISF-EEKFLPLYTRPSPRITAW 484