BLASTX nr result
ID: Catharanthus23_contig00024132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00024132 (675 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311915.2| hypothetical protein POPTR_0008s01010g [Popu... 57 4e-06 ref|XP_006342873.1| PREDICTED: (R)-mandelonitrile lyase-like [So... 57 7e-06 >ref|XP_002311915.2| hypothetical protein POPTR_0008s01010g [Populus trichocarpa] gi|550332107|gb|EEE89282.2| hypothetical protein POPTR_0008s01010g [Populus trichocarpa] Length = 462 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 181 RKIHNVLKSRSMEEF*YQQWFGPRDFRYVGPSLPADL 291 RKI +VL+SRSME+F ++ WFG R+FRYVGP+LP DL Sbjct: 345 RKIGDVLRSRSMEDFMFRGWFGARNFRYVGPALPVDL 381 >ref|XP_006342873.1| PREDICTED: (R)-mandelonitrile lyase-like [Solanum tuberosum] Length = 550 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 181 RKIHNVLKSRSMEEF*YQQWFGPRDFRYVGPSLPAD 288 RKI VL+SR+ME F + QWFG RDFRYVGP+LP D Sbjct: 435 RKIAQVLRSRTMEIFKFDQWFGSRDFRYVGPALPVD 470