BLASTX nr result
ID: Catharanthus23_contig00023617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00023617 (784 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509805.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 >ref|XP_002509805.1| conserved hypothetical protein [Ricinus communis] gi|223549704|gb|EEF51192.1| conserved hypothetical protein [Ricinus communis] Length = 736 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = +1 Query: 1 EEVKNLIEAVTDDDQEKLRVKKKMEEVLPSFVVNPPFSPIARV 129 EEV+ LIEAVT ++++K +V KKME++ S+V+NPPFSPIARV Sbjct: 694 EEVQFLIEAVTKEEEKKKKVSKKMEDIKKSYVLNPPFSPIARV 736