BLASTX nr result
ID: Catharanthus23_contig00023504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00023504 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY16868.1| Ribosomal protein L13 family protein [Theobroma c... 70 3e-10 ref|XP_002456783.1| hypothetical protein SORBIDRAFT_03g042670 [S... 70 3e-10 ref|XP_002323992.1| ribosomal protein L13 [Populus trichocarpa] ... 70 3e-10 ref|XP_006645169.1| PREDICTED: 54S ribosomal protein L23, mitoch... 68 1e-09 ref|XP_004970901.1| PREDICTED: 54S ribosomal protein L23, mitoch... 68 1e-09 dbj|BAC99787.1| putative ribosomal protein I [Oryza sativa Japon... 68 1e-09 gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japo... 68 1e-09 gb|EEC82942.1| hypothetical protein OsI_27916 [Oryza sativa Indi... 68 1e-09 ref|XP_006447125.1| hypothetical protein CICLE_v10016747mg [Citr... 68 1e-09 gb|ACG34410.1| 50S ribosomal protein L13 [Zea mays] 68 1e-09 ref|NP_001141236.1| uncharacterized protein LOC100273323 [Zea ma... 68 1e-09 ref|XP_004957724.1| PREDICTED: 54S ribosomal protein L23, mitoch... 67 2e-09 ref|XP_003578830.1| PREDICTED: 50S ribosomal protein L13-like [B... 67 2e-09 emb|CBI40064.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002270526.1| PREDICTED: 50S ribosomal protein L13-like [V... 67 2e-09 ref|XP_002509553.1| 50S ribosomal protein L13, putative [Ricinus... 67 2e-09 ref|XP_006408548.1| hypothetical protein EUTSA_v10021543mg [Eutr... 65 7e-09 ref|XP_006298568.1| hypothetical protein CARUB_v10014650mg [Caps... 65 7e-09 ref|NP_001236086.1| uncharacterized protein LOC100499790 [Glycin... 65 7e-09 ref|XP_002512531.1| 50S ribosomal protein L13, putative [Ricinus... 65 7e-09 >gb|EOY16868.1| Ribosomal protein L13 family protein [Theobroma cacao] Length = 205 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +2 Query: 134 APAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 A A FNGNLKKALAGLRRINLEGLRWRVFDAKGQVL Sbjct: 5 AAATTFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 41 >ref|XP_002456783.1| hypothetical protein SORBIDRAFT_03g042670 [Sorghum bicolor] gi|241928758|gb|EES01903.1| hypothetical protein SORBIDRAFT_03g042670 [Sorghum bicolor] Length = 199 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +2 Query: 128 MTAPAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 M A A AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 1 MAATAPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 39 >ref|XP_002323992.1| ribosomal protein L13 [Populus trichocarpa] gi|222866994|gb|EEF04125.1| ribosomal protein L13 [Populus trichocarpa] Length = 205 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 134 APAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 A A AFNGN+KKALAGL+RINLEGLRWRVFDAKGQVL Sbjct: 5 AAASAFNGNMKKALAGLKRINLEGLRWRVFDAKGQVL 41 >ref|XP_006645169.1| PREDICTED: 54S ribosomal protein L23, mitochondrial-like [Oryza brachyantha] Length = 203 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 128 MTAPAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 M A AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 1 MAAAPPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 39 >ref|XP_004970901.1| PREDICTED: 54S ribosomal protein L23, mitochondrial-like [Setaria italica] Length = 198 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 134 APAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 A A AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 2 ATAPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 38 >dbj|BAC99787.1| putative ribosomal protein I [Oryza sativa Japonica Group] Length = 229 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 128 MTAPAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 M A AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 1 MAAAPPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 39 >gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group] Length = 864 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 128 MTAPAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 M A AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 636 MAAAPPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 674 >gb|EEC82942.1| hypothetical protein OsI_27916 [Oryza sativa Indica Group] Length = 274 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 128 MTAPAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 M A AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 46 MAAAPPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 84 >ref|XP_006447125.1| hypothetical protein CICLE_v10016747mg [Citrus clementina] gi|567909625|ref|XP_006447126.1| hypothetical protein CICLE_v10016747mg [Citrus clementina] gi|567909629|ref|XP_006447128.1| hypothetical protein CICLE_v10016747mg [Citrus clementina] gi|568831521|ref|XP_006470011.1| PREDICTED: 54S ribosomal protein L23, mitochondrial-like isoform X1 [Citrus sinensis] gi|568831523|ref|XP_006470012.1| PREDICTED: 54S ribosomal protein L23, mitochondrial-like isoform X2 [Citrus sinensis] gi|568831525|ref|XP_006470013.1| PREDICTED: 54S ribosomal protein L23, mitochondrial-like isoform X3 [Citrus sinensis] gi|557549736|gb|ESR60365.1| hypothetical protein CICLE_v10016747mg [Citrus clementina] gi|557549737|gb|ESR60366.1| hypothetical protein CICLE_v10016747mg [Citrus clementina] gi|557549739|gb|ESR60368.1| hypothetical protein CICLE_v10016747mg [Citrus clementina] Length = 203 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +2 Query: 140 AQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 A AF+GN+KKALAGLRRINLEGLRWRVFDAKGQVL Sbjct: 6 ATAFSGNMKKALAGLRRINLEGLRWRVFDAKGQVL 40 >gb|ACG34410.1| 50S ribosomal protein L13 [Zea mays] Length = 199 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 128 MTAPAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 M A AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 1 MAAMPPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 39 >ref|NP_001141236.1| uncharacterized protein LOC100273323 [Zea mays] gi|194703442|gb|ACF85805.1| unknown [Zea mays] gi|413951658|gb|AFW84307.1| putative ribosomal protein L13 family protein [Zea mays] Length = 199 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/39 (84%), Positives = 34/39 (87%) Frame = +2 Query: 128 MTAPAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 M A AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 1 MAAMPPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 39 >ref|XP_004957724.1| PREDICTED: 54S ribosomal protein L23, mitochondrial-like [Setaria italica] Length = 197 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +2 Query: 128 MTAPAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 M + AF GNLKKALAGLRRINL+GLRWRVFDAKGQVL Sbjct: 1 MATTSPAFTGNLKKALAGLRRINLDGLRWRVFDAKGQVL 39 >ref|XP_003578830.1| PREDICTED: 50S ribosomal protein L13-like [Brachypodium distachyon] Length = 271 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/41 (85%), Positives = 36/41 (87%), Gaps = 3/41 (7%) Frame = +2 Query: 131 TAPA---QAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 +APA AF GNLKKALAGLRRINLEGLRWRVFDAKGQVL Sbjct: 67 SAPAGAPPAFTGNLKKALAGLRRINLEGLRWRVFDAKGQVL 107 >emb|CBI40064.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 146 AFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 +FNGN+KKALAGLRRINLEGLRWRVFDAKGQVL Sbjct: 5 SFNGNMKKALAGLRRINLEGLRWRVFDAKGQVL 37 >ref|XP_002270526.1| PREDICTED: 50S ribosomal protein L13-like [Vitis vinifera] Length = 216 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 146 AFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 +FNGN+KKALAGLRRINLEGLRWRVFDAKGQVL Sbjct: 5 SFNGNMKKALAGLRRINLEGLRWRVFDAKGQVL 37 >ref|XP_002509553.1| 50S ribosomal protein L13, putative [Ricinus communis] gi|223549452|gb|EEF50940.1| 50S ribosomal protein L13, putative [Ricinus communis] Length = 202 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 134 APAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 A FNGN+KKALAGLRRINLEGLRWRVFDAKGQVL Sbjct: 2 ASQATFNGNMKKALAGLRRINLEGLRWRVFDAKGQVL 38 >ref|XP_006408548.1| hypothetical protein EUTSA_v10021543mg [Eutrema salsugineum] gi|557109694|gb|ESQ50001.1| hypothetical protein EUTSA_v10021543mg [Eutrema salsugineum] Length = 203 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +2 Query: 140 AQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 A +FNGNLKKA+AG++RINL+GLRWRVFDAKGQVL Sbjct: 6 AASFNGNLKKAMAGIKRINLDGLRWRVFDAKGQVL 40 >ref|XP_006298568.1| hypothetical protein CARUB_v10014650mg [Capsella rubella] gi|482567277|gb|EOA31466.1| hypothetical protein CARUB_v10014650mg [Capsella rubella] Length = 205 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +2 Query: 134 APAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 A A +FNGNLKKA+AG++RINL+GLRWRVFDA+GQVL Sbjct: 6 AAAASFNGNLKKAMAGIKRINLDGLRWRVFDARGQVL 42 >ref|NP_001236086.1| uncharacterized protein LOC100499790 [Glycine max] gi|571552637|ref|XP_006603651.1| PREDICTED: uncharacterized protein LOC100499790 isoform X1 [Glycine max] gi|255626635|gb|ACU13662.1| unknown [Glycine max] Length = 200 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 146 AFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 AFNGN+KKA AGLRRINL+GLRWRVFDAKGQVL Sbjct: 6 AFNGNMKKAAAGLRRINLDGLRWRVFDAKGQVL 38 >ref|XP_002512531.1| 50S ribosomal protein L13, putative [Ricinus communis] gi|223548492|gb|EEF49983.1| 50S ribosomal protein L13, putative [Ricinus communis] Length = 202 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 134 APAQAFNGNLKKALAGLRRINLEGLRWRVFDAKGQVL 244 A +FNGN+KKALAGLRRI+LEGLRWRVFDAKGQVL Sbjct: 2 ASQASFNGNVKKALAGLRRISLEGLRWRVFDAKGQVL 38