BLASTX nr result
ID: Catharanthus23_contig00023091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00023091 (701 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339168.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_004249774.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_002276453.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera] 89 1e-15 ref|XP_004144290.1| PREDICTED: pentatricopeptide repeat-containi... 74 4e-11 gb|EMJ27562.1| hypothetical protein PRUPE_ppa022421mg [Prunus pe... 74 6e-11 gb|EOX91915.1| Pentatricopeptide repeat (PPR) superfamily protei... 73 1e-10 ref|XP_003613018.1| Pentatricopeptide repeat-containing protein ... 72 1e-10 gb|EPS72780.1| hypothetical protein M569_01977, partial [Genlise... 72 2e-10 ref|XP_002326371.1| predicted protein [Populus trichocarpa] gi|5... 72 2e-10 ref|XP_002882332.1| hypothetical protein ARALYDRAFT_896436 [Arab... 64 4e-08 ref|XP_004512571.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_006300966.1| hypothetical protein CARUB_v10021355mg, part... 63 1e-07 ref|XP_002866679.1| pentatricopeptide repeat-containing protein ... 62 1e-07 ref|XP_006279977.1| hypothetical protein CARUB_v10025847mg [Caps... 61 3e-07 gb|EMJ15541.1| hypothetical protein PRUPE_ppa027136mg, partial [... 61 4e-07 ref|XP_006442168.1| hypothetical protein CICLE_v10018770mg [Citr... 59 1e-06 ref|XP_006838717.1| hypothetical protein AMTR_s00002p00251730 [A... 58 3e-06 ref|XP_003533421.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-06 ref|NP_201359.1| pentatricopeptide repeat-containing protein [Ar... 56 1e-05 >ref|XP_006339168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Solanum tuberosum] gi|565344128|ref|XP_006339169.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Solanum tuberosum] gi|565344130|ref|XP_006339170.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X3 [Solanum tuberosum] gi|565344132|ref|XP_006339171.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X4 [Solanum tuberosum] Length = 915 Score = 99.4 bits (246), Expect = 1e-18 Identities = 57/104 (54%), Positives = 71/104 (68%), Gaps = 11/104 (10%) Frame = +1 Query: 361 KQGQS-TLFF--LSNKPFSVVPS-------IAYPISSESIVTD-VSTQLYSLLTRPNWQK 507 + GQS +LFF + + PFSV PS I P SE I D +S+QL +LL+ PNWQK Sbjct: 14 RSGQSISLFFSLIKSFPFSVAPSPSSSPSPILSPEESEPISIDPLSSQLLNLLSHPNWQK 73 Query: 508 NPNFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYLCRLPSF 639 +P+ K LIP+LSPS +S FL+Q PNLNP A +FFDYL RLPSF Sbjct: 74 HPSLKNLIPSLSPSRLSSFLSQNPNLNPHIAFSFFDYLSRLPSF 117 >ref|XP_004249774.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Solanum lycopersicum] Length = 913 Score = 94.0 bits (232), Expect = 4e-17 Identities = 54/102 (52%), Positives = 67/102 (65%), Gaps = 9/102 (8%) Frame = +1 Query: 361 KQGQS-TLFFLSNKPF-------SVVPSIAYPISSESIVTD-VSTQLYSLLTRPNWQKNP 513 + GQS +LFF K F S SI P SE I D +S+QL +LL+ PNWQK+P Sbjct: 14 RSGQSISLFFTLIKSFPFSSSSSSSPSSILSPEESEPISIDPLSSQLLNLLSHPNWQKHP 73 Query: 514 NFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYLCRLPSF 639 + K LIP+LSPS +S FL+Q PNLNP A +FFDYL R+PSF Sbjct: 74 SLKNLIPSLSPSRLSSFLSQNPNLNPHIAFSFFDYLSRIPSF 115 >ref|XP_002276453.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560 [Vitis vinifera] gi|296084392|emb|CBI24780.3| unnamed protein product [Vitis vinifera] Length = 890 Score = 89.0 bits (219), Expect = 1e-15 Identities = 47/102 (46%), Positives = 71/102 (69%) Frame = +1 Query: 334 LRSAASINIKQGQSTLFFLSNKPFSVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQKNP 513 +R +A+I IK G+ L L KP+S + S+ +S +S D+S QL S+L+RPNWQK+P Sbjct: 1 MRKSAAI-IKPGEYLLILL--KPYSSIASLPQILSLDSEPVDLSAQLLSILSRPNWQKHP 57 Query: 514 NFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYLCRLPSF 639 + +KL+P+L+PSH+S A NL+PQTAL+FF+++ P F Sbjct: 58 SLRKLLPSLTPSHVSSLFAF--NLDPQTALSFFNWIALRPGF 97 >emb|CAN80799.1| hypothetical protein VITISV_019809 [Vitis vinifera] Length = 1099 Score = 89.0 bits (219), Expect = 1e-15 Identities = 47/102 (46%), Positives = 71/102 (69%) Frame = +1 Query: 334 LRSAASINIKQGQSTLFFLSNKPFSVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQKNP 513 +R +A+I IK G+ L L KP+S + S+ +S +S D+S QL S+L+RPNWQK+P Sbjct: 1 MRKSAAI-IKPGEYLLILL--KPYSSIASLPQILSLDSEPVDLSAQLLSILSRPNWQKHP 57 Query: 514 NFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYLCRLPSF 639 + +KL+P+L+PSH+S A NL+PQTAL+FF+++ P F Sbjct: 58 SLRKLLPSLTPSHVSSLFAF--NLDPQTALSFFNWIALRPGF 97 >ref|XP_004144290.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] gi|449522905|ref|XP_004168466.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Cucumis sativus] Length = 915 Score = 73.9 bits (180), Expect = 4e-11 Identities = 42/103 (40%), Positives = 66/103 (64%) Frame = +1 Query: 313 IQSSTTMLRSAASINIKQGQSTLFFLSNKPFSVVPSIAYPISSESIVTDVSTQLYSLLTR 492 I++ST +++S + + + L F F P+ + P S S+ D+ QL+S+L+R Sbjct: 2 IRNSTAIIKSGQLLVVLGFRLRLTFSITHRFFTSPA-SLP-QSFSVEHDIPAQLFSILSR 59 Query: 493 PNWQKNPNFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYL 621 PNWQK+P+ K LIP+++PSHIS A NL+PQTAL FF+++ Sbjct: 60 PNWQKHPSLKNLIPSIAPSHISALFAL--NLDPQTALAFFNWI 100 >gb|EMJ27562.1| hypothetical protein PRUPE_ppa022421mg [Prunus persica] Length = 845 Score = 73.6 bits (179), Expect = 6e-11 Identities = 37/87 (42%), Positives = 58/87 (66%), Gaps = 6/87 (6%) Frame = +1 Query: 397 KPFSVVPSIAY------PISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHIS 558 KPFS + A P+ + + D+S+QL+++L+RPNWQ++P+ KKLIP++S SH+S Sbjct: 29 KPFSTSSTTAAASPSLPPVPEQPV--DLSSQLFAILSRPNWQRHPSLKKLIPSISASHVS 86 Query: 559 DFLAQYPNLNPQTALNFFDYLCRLPSF 639 A NL+PQTAL FF+++ P + Sbjct: 87 SLFAL--NLDPQTALGFFNWIALKPGY 111 >gb|EOX91915.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508700020|gb|EOX91916.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 946 Score = 72.8 bits (177), Expect = 1e-10 Identities = 41/117 (35%), Positives = 68/117 (58%) Frame = +1 Query: 289 IHGALISTIQSSTTMLRSAASINIKQGQSTLFFLSNKPFSVVPSIAYPISSESIVTDVST 468 ++G+ T + TM A +N Q L L+ K S PS + P+ + D+ Sbjct: 28 MNGSPTITTVRAPTMRNPIAIVNPGQSFHFLSILA-KSLSSFPS-SLPLDPDPPDHDIPL 85 Query: 469 QLYSLLTRPNWQKNPNFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYLCRLPSF 639 L+S+L++PNWQ++P+ KLIP++SPSH+ + PNL P+TAL+F ++ + P+F Sbjct: 86 LLHSILSKPNWQRHPSLPKLIPSISPSHVHSLFSLNPNLLPKTALDFSYWISKKPNF 142 >ref|XP_003613018.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355514353|gb|AES95976.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 894 Score = 72.4 bits (176), Expect = 1e-10 Identities = 39/89 (43%), Positives = 58/89 (65%) Frame = +1 Query: 355 NIKQGQSTLFFLSNKPFSVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIP 534 N Q Q+ LF L KPFS +S S+ D+ +Q++++L +P W+KNP+F LIP Sbjct: 14 NQNQNQN-LFHLLLKPFS-------SLSPNSLQQDLPSQIFTILLQPQWRKNPSFNTLIP 65 Query: 535 NLSPSHISDFLAQYPNLNPQTALNFFDYL 621 +L+P+H+S L PNL+P TALNFF ++ Sbjct: 66 SLTPTHLSS-LFNNPNLHPLTALNFFKWI 93 >gb|EPS72780.1| hypothetical protein M569_01977, partial [Genlisea aurea] Length = 897 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/85 (42%), Positives = 47/85 (55%) Frame = +1 Query: 385 FLSNKPFSVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHISDF 564 F FS+ P P S S V + L+S+L RPNW K+P+ K ++SP S F Sbjct: 30 FFKQLSFSISPEPISPPESSSAV--LCRDLFSILCRPNWPKDPSLKNFFHSISPPLFSSF 87 Query: 565 LAQYPNLNPQTALNFFDYLCRLPSF 639 L+QYP+LNP A FF +L PSF Sbjct: 88 LSQYPHLNPHVAFQFFRFLSSAPSF 112 >ref|XP_002326371.1| predicted protein [Populus trichocarpa] gi|566175973|ref|XP_006381417.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550336120|gb|ERP59214.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 726 Score = 71.6 bits (174), Expect = 2e-10 Identities = 41/110 (37%), Positives = 63/110 (57%), Gaps = 5/110 (4%) Frame = +1 Query: 307 STIQSSTTMLRSAASINIKQGQSTLFFLSNKPFSVVPSIAYPISSESIVTDVSTQL---- 474 S ++ S+ ++ S++S + S +F KP S S + I+S + D L Sbjct: 3 SVMRKSSFVIPSSSS---GESSSPIFHHLKKPISSSSSPSSSIASLPVEPDPPDDLSSHH 59 Query: 475 -YSLLTRPNWQKNPNFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYL 621 S+L+ P WQ++P+F+KLIPNLSPSH+S +P+LNP AL FF+ L Sbjct: 60 FLSILSHPKWQRHPSFQKLIPNLSPSHVSSLFNNHPDLNPNIALQFFNSL 109 >ref|XP_002882332.1| hypothetical protein ARALYDRAFT_896436 [Arabidopsis lyrata subsp. lyrata] gi|297328172|gb|EFH58591.1| hypothetical protein ARALYDRAFT_896436 [Arabidopsis lyrata subsp. lyrata] Length = 790 Score = 64.3 bits (155), Expect = 4e-08 Identities = 32/87 (36%), Positives = 53/87 (60%), Gaps = 1/87 (1%) Frame = +1 Query: 382 FFLSNKPFSVVPSIAY-PISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHIS 558 + L PFS ++ + P +ES + + L S+L++PNWQ NP+ K L+P ++PSH+S Sbjct: 13 YLLRRIPFSSTSTLLHTPPEAESDPSHLPHHLLSILSKPNWQNNPSLKSLLPAITPSHVS 72 Query: 559 DFLAQYPNLNPQTALNFFDYLCRLPSF 639 + NL+P TAL F ++ + P+F Sbjct: 73 SLFSL--NLDPHTALQFSYWISQTPNF 97 >ref|XP_004512571.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Cicer arietinum] gi|502162660|ref|XP_004512572.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Cicer arietinum] Length = 927 Score = 63.9 bits (154), Expect = 5e-08 Identities = 33/81 (40%), Positives = 50/81 (61%) Frame = +1 Query: 379 LFFLSNKPFSVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHIS 558 LF + KPFS +P D+ +Q+Y++L+ P W+K+P+F LIP+L+P+HIS Sbjct: 17 LFHVLFKPFSSLPQ----------QPDLPSQIYTILSNPQWRKDPSFNTLIPSLTPTHIS 66 Query: 559 DFLAQYPNLNPQTALNFFDYL 621 NL+P TALNFF ++ Sbjct: 67 SLFNL--NLHPLTALNFFKWI 85 >ref|XP_006300966.1| hypothetical protein CARUB_v10021355mg, partial [Capsella rubella] gi|482569676|gb|EOA33864.1| hypothetical protein CARUB_v10021355mg, partial [Capsella rubella] Length = 750 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/66 (42%), Positives = 44/66 (66%) Frame = +1 Query: 442 ESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYL 621 ES +++ QL S+ + PNWQ NP+ K L+P ++PSH+S + NL+P TAL+F D++ Sbjct: 18 ESDSSNLPCQLLSIFSEPNWQNNPSLKSLVPAITPSHVSSLFSL--NLDPLTALSFSDWI 75 Query: 622 CRLPSF 639 + P F Sbjct: 76 SQTPKF 81 >ref|XP_002866679.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312514|gb|EFH42938.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 915 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/78 (39%), Positives = 49/78 (62%) Frame = +1 Query: 406 SVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHISDFLAQYPNL 585 SV P I ES T V +L+S+L++PNW K P+ K ++P +SPSH+S + +L Sbjct: 44 SVSPLIRNLPEDESDPTSVPHRLFSILSKPNWHKCPSLKSMVPAISPSHVSSLFSL--DL 101 Query: 586 NPQTALNFFDYLCRLPSF 639 +P+TALNF ++ + P + Sbjct: 102 DPKTALNFSHWISQNPRY 119 >ref|XP_006279977.1| hypothetical protein CARUB_v10025847mg [Capsella rubella] gi|482548681|gb|EOA12875.1| hypothetical protein CARUB_v10025847mg [Capsella rubella] Length = 915 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/78 (38%), Positives = 49/78 (62%) Frame = +1 Query: 406 SVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHISDFLAQYPNL 585 S P I + ES T V +L S+L++PNW K+P+ + ++P +SPSH+S + +L Sbjct: 44 SASPLIRTLPAEESDPTSVPHRLLSILSKPNWHKSPSLRSMVPAISPSHVSSLFSL--DL 101 Query: 586 NPQTALNFFDYLCRLPSF 639 +P+TALNF ++ + P F Sbjct: 102 DPKTALNFSHWISQNPRF 119 >gb|EMJ15541.1| hypothetical protein PRUPE_ppa027136mg, partial [Prunus persica] Length = 783 Score = 60.8 bits (146), Expect = 4e-07 Identities = 36/110 (32%), Positives = 60/110 (54%) Frame = +1 Query: 310 TIQSSTTMLRSAASINIKQGQSTLFFLSNKPFSVVPSIAYPISSESIVTDVSTQLYSLLT 489 T+ S M+ + I Q+ FL PFS +I D+S++L+++L+ Sbjct: 2 TLPKSFLMMMRKLTAVISPHQTLQLFL-RMPFSC-----------TIKRDISSELFAVLS 49 Query: 490 RPNWQKNPNFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYLCRLPSF 639 P WQK+P+ KL+P++SPSH+S A L+P+ A++FF ++ R F Sbjct: 50 SPKWQKHPSLGKLMPSISPSHVSSLFAL--KLDPKIAIDFFCWIARTRRF 97 >ref|XP_006442168.1| hypothetical protein CICLE_v10018770mg [Citrus clementina] gi|557544430|gb|ESR55408.1| hypothetical protein CICLE_v10018770mg [Citrus clementina] Length = 910 Score = 59.3 bits (142), Expect = 1e-06 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 3/104 (2%) Frame = +1 Query: 337 RSAASINIKQGQSTLFFLSNKPFSVVPSIA-YPISSESIVTDVSTQLYSLL-TRPN-WQK 507 R+ A+I +S FL PF SI+ P+ + D+ +Q++++L T P WQ+ Sbjct: 4 RTPAAIFTAFTKSPGQFLIKYPFCTSSSISSLPLPLDPDPPDLPSQIFTILSTHPTTWQR 63 Query: 508 NPNFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYLCRLPSF 639 +P+ KLIP LSPSHIS + +LNPQTAL+F ++ + P F Sbjct: 64 HPSITKLIPLLSPSHISSLFSL--DLNPQTALDFSYWISQKPGF 105 >ref|XP_006838717.1| hypothetical protein AMTR_s00002p00251730 [Amborella trichopoda] gi|548841223|gb|ERN01286.1| hypothetical protein AMTR_s00002p00251730 [Amborella trichopoda] Length = 904 Score = 58.2 bits (139), Expect = 3e-06 Identities = 33/105 (31%), Positives = 59/105 (56%), Gaps = 3/105 (2%) Frame = +1 Query: 334 LRSAASINIKQGQSTLFFLSNKPF---SVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQ 504 +R A++ N Q ++ L L+ + + S P S ++ + D+ +Q+ + + RP WQ Sbjct: 1 MRRASTFNPGQSKTILMLLNKRLLHFTKCISSFPIPDSPDAELFDLPSQVRAAIVRPGWQ 60 Query: 505 KNPNFKKLIPNLSPSHISDFLAQYPNLNPQTALNFFDYLCRLPSF 639 KNP FKKL +L+P H+ L L+ + ALNFF ++ ++P + Sbjct: 61 KNPFFKKLAFSLTPFHVCKVLELI--LDTKIALNFFFWMGQVPGY 103 >ref|XP_003533421.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X1 [Glycine max] gi|571478486|ref|XP_006587579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X2 [Glycine max] gi|571478488|ref|XP_006587580.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like isoform X3 [Glycine max] Length = 892 Score = 56.6 bits (135), Expect = 7e-06 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 2/72 (2%) Frame = +1 Query: 430 PISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHISDFLAQYPNLNPQ--TAL 603 P SS S + + TQ++++L+RP W+K+P+ K LIP+L+PS L NLNP TAL Sbjct: 17 PFSSSS--SSLPTQIFTILSRPRWRKDPSLKTLIPSLTPS----LLCSLFNLNPDPLTAL 70 Query: 604 NFFDYLCRLPSF 639 NFF ++ R +F Sbjct: 71 NFFRWIRRHHNF 82 >ref|NP_201359.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180383|sp|Q9LSL9.1|PP445_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g65560 gi|8978284|dbj|BAA98175.1| unnamed protein product [Arabidopsis thaliana] gi|110737310|dbj|BAF00601.1| hypothetical protein [Arabidopsis thaliana] gi|332010688|gb|AED98071.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 915 Score = 56.2 bits (134), Expect = 1e-05 Identities = 28/78 (35%), Positives = 47/78 (60%) Frame = +1 Query: 406 SVVPSIAYPISSESIVTDVSTQLYSLLTRPNWQKNPNFKKLIPNLSPSHISDFLAQYPNL 585 SV P + ES V +L S+L++PNW K+P+ K ++ +SPSH+S + +L Sbjct: 44 SVSPLLRNLPEEESDSMSVPHRLLSILSKPNWHKSPSLKSMVSAISPSHVSSLFSL--DL 101 Query: 586 NPQTALNFFDYLCRLPSF 639 +P+TALNF ++ + P + Sbjct: 102 DPKTALNFSHWISQNPRY 119