BLASTX nr result
ID: Catharanthus23_contig00022937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00022937 (243 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68249.1| hypothetical protein M569_06523 [Genlisea aurea] 59 7e-07 >gb|EPS68249.1| hypothetical protein M569_06523 [Genlisea aurea] Length = 255 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = -3 Query: 214 MDNGPNPPPDLPREFKQALEEFAQGRTITDLKLVIQKGTTATDMSTCHNRLSLPARHILN 35 ++NGPNPPP LP F+ A++ F + ++ ++QK TD+S HNRLS+P I Sbjct: 98 LENGPNPPPPLPANFRMAIDCFDEKTAKREVNFILQKRLCKTDLSDGHNRLSIPKNQIRK 157 Query: 34 P-FLTEQE 14 P FL E Sbjct: 158 PDFLLPSE 165