BLASTX nr result
ID: Catharanthus23_contig00022850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00022850 (488 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_683473.1| uncharacterized protein [Arabidopsis thaliana] ... 56 6e-06 >ref|NP_683473.1| uncharacterized protein [Arabidopsis thaliana] gi|332196359|gb|AEE34480.1| uncharacterized protein AT1G66235 [Arabidopsis thaliana] Length = 265 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/61 (42%), Positives = 41/61 (67%) Frame = -3 Query: 363 QNMAFQKENMAFRKWREENKILDKNLAQISDPNSRAYVAAEQRGIMQRRLQEQQHLPNTM 184 Q + Q +++A R+ +EENK+L +NL I DPN RAY+ +EQ I+++RL +Q +T Sbjct: 204 QYLEMQSKSLALREQKEENKVLYRNLNSIEDPNLRAYLQSEQAKILRKRLDQQAASTSTS 263 Query: 183 F 181 F Sbjct: 264 F 264