BLASTX nr result
ID: Catharanthus23_contig00022827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00022827 (691 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20014.1| Phosphate transporter PHO1-10-like protein [Morus... 57 7e-06 >gb|EXC20014.1| Phosphate transporter PHO1-10-like protein [Morus notabilis] Length = 754 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = +1 Query: 214 YSFYLYSTVPCLSLAVASYFWRLYVINNPFIFGF*RVTKLGYRKYF 351 YS +LY + L A YFWR Y INNPFIFGF R T+LGYR+ F Sbjct: 343 YSVFLYIVLHMLVYAANIYFWRRYRINNPFIFGFKRGTELGYREVF 388