BLASTX nr result
ID: Catharanthus23_contig00022493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00022493 (621 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY03516.1| Uncharacterized protein TCM_018610 [Theobroma cacao] 59 9e-07 ref|XP_006482623.1| PREDICTED: uncharacterized protein LOC102620... 57 6e-06 >gb|EOY03516.1| Uncharacterized protein TCM_018610 [Theobroma cacao] Length = 53 Score = 59.3 bits (142), Expect = 9e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 262 MNPNLSSLLIGIMGAAITLSAYSQTLISPTQCI 360 MN NLSSLLIG++GAAITLSAYSQT ISPTQC+ Sbjct: 1 MNQNLSSLLIGLVGAAITLSAYSQTFISPTQCV 33 >ref|XP_006482623.1| PREDICTED: uncharacterized protein LOC102620178 [Citrus sinensis] Length = 53 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 262 MNPNLSSLLIGIMGAAITLSAYSQTLISPTQCI 360 MN NLSSLLIG++GA ITLSAYSQTLIS TQCI Sbjct: 1 MNQNLSSLLIGLVGAVITLSAYSQTLISSTQCI 33