BLASTX nr result
ID: Catharanthus23_contig00022390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00022390 (1233 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002862935.1| low-molecular-weight cysteine-rich 76 [Arabi... 59 5e-06 >ref|XP_002862935.1| low-molecular-weight cysteine-rich 76 [Arabidopsis lyrata subsp. lyrata] gi|297822943|ref|XP_002879354.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297308715|gb|EFH39194.1| low-molecular-weight cysteine-rich 76 [Arabidopsis lyrata subsp. lyrata] gi|297325193|gb|EFH55613.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 83 Score = 58.5 bits (140), Expect = 5e-06 Identities = 29/76 (38%), Positives = 42/76 (55%) Frame = -1 Query: 327 FLLVLNLIR*MAVVIEKQSMFKFVEGGKFCWKASRLYRGFCLRDANCETLCIQEGYSTGA 148 FL++L + M +V+E Q + C S YRG C++ NC+ +CI EG+ G Sbjct: 13 FLVILVVAPGMKMVVEGQP--------QLCETKSLNYRGLCMKWRNCKRVCISEGFPDGR 64 Query: 147 *KGFLNRKCMCGRDCA 100 KGF N KC+C + CA Sbjct: 65 CKGFFNNKCVCRKPCA 80