BLASTX nr result
ID: Catharanthus23_contig00022220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00022220 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600525.1| Cc-nbs-lrr resistance protein [Medicago trun... 55 7e-06 >ref|XP_003600525.1| Cc-nbs-lrr resistance protein [Medicago truncatula] gi|355489573|gb|AES70776.1| Cc-nbs-lrr resistance protein [Medicago truncatula] Length = 924 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/72 (31%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Frame = +3 Query: 87 LSAFMPILA-PYINDFLEAIKKQSSYMCCYHCNVESLRGEIPDLDVERATLQQRADAGTR 263 +++F+ LA PY++ + + +SSY+CC+ C + E L++E+ T++QR D T Sbjct: 1 MASFLTDLAKPYVDKLINGVIAESSYICCFTCIAKDFEEERVSLEIEKTTVKQRVDVATS 60 Query: 264 KGETVRPDVEDW 299 +GE V+ + W Sbjct: 61 RGEDVQANALSW 72