BLASTX nr result
ID: Catharanthus23_contig00021858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00021858 (281 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482316.1| PREDICTED: protein YLS7-like [Citrus sinensis] 57 3e-06 ref|XP_006430842.1| hypothetical protein CICLE_v10011721mg [Citr... 57 3e-06 >ref|XP_006482316.1| PREDICTED: protein YLS7-like [Citrus sinensis] Length = 446 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/73 (38%), Positives = 39/73 (53%) Frame = -2 Query: 220 SVVPAHYPLPRNNWLSDSAAENSSELSPPLNIKAQXXXXXEKLMKFVEINEECDISNGEW 41 +++ HYPL N S +S P + +K VE +E+CDI +GEW Sbjct: 31 AIISLHYPLSGNPIFGFSKYYSSPSPEPSSPSSLNNNDADQGSIKEVEGSEKCDIFSGEW 90 Query: 40 IPNPEAPYYTNTS 2 +PNPE PYYTNT+ Sbjct: 91 VPNPEGPYYTNTT 103 >ref|XP_006430842.1| hypothetical protein CICLE_v10011721mg [Citrus clementina] gi|557532899|gb|ESR44082.1| hypothetical protein CICLE_v10011721mg [Citrus clementina] Length = 446 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/73 (38%), Positives = 39/73 (53%) Frame = -2 Query: 220 SVVPAHYPLPRNNWLSDSAAENSSELSPPLNIKAQXXXXXEKLMKFVEINEECDISNGEW 41 +++ HYPL N S +S P + +K VE +E+CDI +GEW Sbjct: 31 AIISLHYPLSGNPIFGFSKYYSSPSPEPSSPSSLNNNDSDQVSIKEVEGSEKCDIFSGEW 90 Query: 40 IPNPEAPYYTNTS 2 +PNPE PYYTNT+ Sbjct: 91 VPNPEGPYYTNTT 103