BLASTX nr result
ID: Catharanthus23_contig00020726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00020726 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362958.1| PREDICTED: cytochrome c oxidase copper chape... 82 1e-13 ref|XP_004248263.1| PREDICTED: cytochrome c oxidase copper chape... 82 1e-13 gb|EPS72765.1| hypothetical protein M569_01995, partial [Genlise... 79 5e-13 gb|EXC35137.1| Cytochrome c oxidase copper chaperone [Morus nota... 78 1e-12 ref|XP_006348248.1| PREDICTED: cytochrome c oxidase copper chape... 78 1e-12 ref|XP_006451855.1| hypothetical protein CICLE_v10010072mg [Citr... 78 1e-12 gb|EOY13007.1| Cytochrome C oxidase copper chaperone isoform 2, ... 78 1e-12 gb|EOY13006.1| Cytochrome C oxidase copper chaperone isoform 1 [... 78 1e-12 ref|XP_004244230.1| PREDICTED: cytochrome c oxidase copper chape... 78 1e-12 ref|XP_002531715.1| Cytochrome c oxidase copper chaperone, putat... 77 3e-12 ref|XP_004133710.1| PREDICTED: cytochrome c oxidase copper chape... 76 4e-12 emb|CBI20303.3| unnamed protein product [Vitis vinifera] 76 4e-12 ref|XP_002285003.1| PREDICTED: cytochrome c oxidase copper chape... 76 4e-12 emb|CAN74977.1| hypothetical protein VITISV_027197 [Vitis vinifera] 76 4e-12 ref|XP_002317498.2| cytochrome c oxidase copper chaperone-relate... 75 7e-12 ref|XP_006304838.1| hypothetical protein CARUB_v10012519mg [Caps... 75 7e-12 ref|XP_002329088.1| predicted protein [Populus trichocarpa] gi|5... 75 7e-12 ref|XP_006406979.1| hypothetical protein EUTSA_v10021884mg [Eutr... 75 1e-11 ref|XP_004954210.1| PREDICTED: cytochrome c oxidase copper chape... 75 1e-11 ref|NP_001048378.1| Os02g0794600 [Oryza sativa Japonica Group] g... 75 1e-11 >ref|XP_006362958.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum tuberosum] Length = 79 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKKLRDECIVEHGESACEK+IEAHRKCLR Sbjct: 38 ICCACPETKKLRDECIVEHGESACEKWIEAHRKCLR 73 >ref|XP_004248263.1| PREDICTED: cytochrome c oxidase copper chaperone-like isoform 1 [Solanum lycopersicum] gi|460405601|ref|XP_004248264.1| PREDICTED: cytochrome c oxidase copper chaperone-like isoform 2 [Solanum lycopersicum] Length = 79 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKKLRDECIVEHGESACEK+IEAHRKCLR Sbjct: 38 ICCACPETKKLRDECIVEHGESACEKWIEAHRKCLR 73 >gb|EPS72765.1| hypothetical protein M569_01995, partial [Genlisea aurea] Length = 50 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TKKLRDECIVEHGESACEK+IEAH+KCLR Sbjct: 9 ICCACPDTKKLRDECIVEHGESACEKWIEAHKKCLR 44 >gb|EXC35137.1| Cytochrome c oxidase copper chaperone [Morus notabilis] gi|587978046|gb|EXC62695.1| Cytochrome c oxidase copper chaperone [Morus notabilis] Length = 80 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKKLRDECIVEHGE AC K+IEAHRKCLR Sbjct: 39 ICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLR 74 >ref|XP_006348248.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Solanum tuberosum] Length = 88 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKK+RDECIVEHGESACEK+IEAH KCLR Sbjct: 47 ICCACPETKKVRDECIVEHGESACEKWIEAHLKCLR 82 >ref|XP_006451855.1| hypothetical protein CICLE_v10010072mg [Citrus clementina] gi|568820489|ref|XP_006464748.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Citrus sinensis] gi|557555081|gb|ESR65095.1| hypothetical protein CICLE_v10010072mg [Citrus clementina] Length = 80 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKKLRDECIVEHGE AC K+IEAHRKCLR Sbjct: 39 ICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLR 74 >gb|EOY13007.1| Cytochrome C oxidase copper chaperone isoform 2, partial [Theobroma cacao] Length = 109 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKKLRDECIVEHGE AC K+IEAHRKCLR Sbjct: 68 ICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLR 103 >gb|EOY13006.1| Cytochrome C oxidase copper chaperone isoform 1 [Theobroma cacao] Length = 78 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKKLRDECIVEHGE AC K+IEAHRKCLR Sbjct: 37 ICCACPETKKLRDECIVEHGEEACAKWIEAHRKCLR 72 >ref|XP_004244230.1| PREDICTED: cytochrome c oxidase copper chaperone-like [Solanum lycopersicum] Length = 88 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKK+RDECIVEHGESACEK+IEAH KCLR Sbjct: 47 ICCACPETKKVRDECIVEHGESACEKWIEAHLKCLR 82 >ref|XP_002531715.1| Cytochrome c oxidase copper chaperone, putative [Ricinus communis] gi|223528658|gb|EEF30674.1| Cytochrome c oxidase copper chaperone, putative [Ricinus communis] Length = 80 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TKKLRDECIVEHGESAC K+IEAHR+CLR Sbjct: 39 ICCACPDTKKLRDECIVEHGESACAKWIEAHRQCLR 74 >ref|XP_004133710.1| PREDICTED: cytochrome c oxidase copper chaperone-like isoform 1 [Cucumis sativus] gi|449431846|ref|XP_004133711.1| PREDICTED: cytochrome c oxidase copper chaperone-like isoform 2 [Cucumis sativus] gi|449431848|ref|XP_004133712.1| PREDICTED: cytochrome c oxidase copper chaperone-like isoform 3 [Cucumis sativus] Length = 80 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TKKLRDECIVEHGE AC K+IEAHRKCLR Sbjct: 39 ICCACPDTKKLRDECIVEHGEEACGKWIEAHRKCLR 74 >emb|CBI20303.3| unnamed protein product [Vitis vinifera] Length = 167 Score = 76.3 bits (186), Expect = 4e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TKK+RD+CIVEHGE+ACEK+IEAHR+CLR Sbjct: 126 ICCACPDTKKIRDDCIVEHGEAACEKWIEAHRRCLR 161 >ref|XP_002285003.1| PREDICTED: cytochrome c oxidase copper chaperone-like [Vitis vinifera] Length = 75 Score = 76.3 bits (186), Expect = 4e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TKK+RD+CIVEHGE+ACEK+IEAHR+CLR Sbjct: 34 ICCACPDTKKIRDDCIVEHGEAACEKWIEAHRRCLR 69 >emb|CAN74977.1| hypothetical protein VITISV_027197 [Vitis vinifera] Length = 269 Score = 76.3 bits (186), Expect = 4e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TKK+RD+CIVEHGE+ACEK+IEAHR+CLR Sbjct: 228 ICCACPDTKKIRDDCIVEHGEAACEKWIEAHRRCLR 263 >ref|XP_002317498.2| cytochrome c oxidase copper chaperone-related family protein [Populus trichocarpa] gi|550328193|gb|EEE98110.2| cytochrome c oxidase copper chaperone-related family protein [Populus trichocarpa] Length = 75 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKKLRDECIVEHGE+AC K+I+AHR+CLR Sbjct: 34 ICCACPETKKLRDECIVEHGEAACAKWIDAHRQCLR 69 >ref|XP_006304838.1| hypothetical protein CARUB_v10012519mg [Capsella rubella] gi|482573549|gb|EOA37736.1| hypothetical protein CARUB_v10012519mg [Capsella rubella] Length = 72 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TKKLRDECIVEHGESAC K+IEAHR CLR Sbjct: 31 ICCACPDTKKLRDECIVEHGESACTKWIEAHRLCLR 66 >ref|XP_002329088.1| predicted protein [Populus trichocarpa] gi|566154010|ref|XP_006370260.1| cytochrome c oxidase copper chaperone-related family protein [Populus trichocarpa] gi|550349439|gb|ERP66829.1| cytochrome c oxidase copper chaperone-related family protein [Populus trichocarpa] Length = 75 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACPETKKLRDECIVEHGE+AC K+IEAHR CLR Sbjct: 34 ICCACPETKKLRDECIVEHGEAACAKWIEAHRLCLR 69 >ref|XP_006406979.1| hypothetical protein EUTSA_v10021884mg [Eutrema salsugineum] gi|557108125|gb|ESQ48432.1| hypothetical protein EUTSA_v10021884mg [Eutrema salsugineum] Length = 70 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TKKLRDECIVEHGESAC K+IEAH+ CLR Sbjct: 29 ICCACPDTKKLRDECIVEHGESACTKWIEAHKMCLR 64 >ref|XP_004954210.1| PREDICTED: cytochrome c oxidase copper chaperone-like [Setaria italica] Length = 80 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TK+LRDECIVEHGESAC K+IEAH++CLR Sbjct: 39 ICCACPDTKRLRDECIVEHGESACTKWIEAHKRCLR 74 >ref|NP_001048378.1| Os02g0794600 [Oryza sativa Japonica Group] gi|47497218|dbj|BAD19263.1| putative copper chaperone COX17-1 [Oryza sativa Japonica Group] gi|47497602|dbj|BAD19672.1| putative copper chaperone COX17-1 [Oryza sativa Japonica Group] gi|113537909|dbj|BAF10292.1| Os02g0794600 [Oryza sativa Japonica Group] gi|218191738|gb|EEC74165.1| hypothetical protein OsI_09266 [Oryza sativa Indica Group] gi|222623833|gb|EEE57965.1| hypothetical protein OsJ_08703 [Oryza sativa Japonica Group] Length = 79 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 109 ICCACPETKKLRDECIVEHGESACEKFIEAHRKCLR 2 ICCACP+TK+LRDECIVEHGESAC K+IEAH++CLR Sbjct: 38 ICCACPDTKRLRDECIVEHGESACTKWIEAHKRCLR 73