BLASTX nr result
ID: Catharanthus23_contig00020295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00020295 (406 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611791.1| hypothetical protein MTR_5g017880 [Medicago ... 61 2e-07 gb|EOX91334.1| Uncharacterized protein TCM_000563 [Theobroma cacao] 60 3e-07 >ref|XP_003611791.1| hypothetical protein MTR_5g017880 [Medicago truncatula] gi|355513126|gb|AES94749.1| hypothetical protein MTR_5g017880 [Medicago truncatula] Length = 79 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = -3 Query: 299 MEPPQVQSIDTKNIPPPEDEHDKVIDGCCSCLYDCSDGCLGYFCCS 162 M+PPQ QSID N P +D DK+I+ CCSC YDC+ G + CCS Sbjct: 1 MDPPQTQSIDISN-PAGDDLQDKIINDCCSCCYDCTQGFFDFLCCS 45 >gb|EOX91334.1| Uncharacterized protein TCM_000563 [Theobroma cacao] Length = 51 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/47 (53%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -3 Query: 299 MEPPQVQSIDTK--NIPPPEDEHDKVIDGCCSCLYDCSDGCLGYFCC 165 ME P QSI+T N EDE DK +D CCSC YDC++ C Y CC Sbjct: 1 MEAPATQSIETSTNNFQVEEDEQDKAVDECCSCCYDCTETCFDYLCC 47