BLASTX nr result
ID: Catharanthus23_contig00019933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00019933 (785 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ20613.1| hypothetical protein PRUPE_ppa021915mg, partial [... 45 6e-06 >gb|EMJ20613.1| hypothetical protein PRUPE_ppa021915mg, partial [Prunus persica] Length = 509 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 22/84 (26%), Positives = 37/84 (44%) Frame = -3 Query: 750 CYICESESET*EQLLFRCPLTVELWWNSPWQIRMEGFKDWNIQQWFEELSQDSNSSPLPI 571 C +CE+ E+ E L CP T +W+ SP R+ W + Q + +S I Sbjct: 279 CPVCENNEESVEHLFLLCPWTAAVWFGSPLNYRVHNQSITTFDNWLNSMFQLNLTS---I 335 Query: 570 EDKKQILNFAMVCLERVWMYKTKF 499 D+ +++ L +W + KF Sbjct: 336 LDRNRLMTIISFILWEIWKARCKF 359 Score = 32.0 bits (71), Expect(2) = 6e-06 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -2 Query: 397 ISINKRNIWNPPLLGWIKLNFDAAYI---NREGTVVVIR 290 +++ W PP G++K+N DAA+I NR VVIR Sbjct: 396 VTLISTRAWTPPSDGFVKVNTDAAWIKESNRSAVGVVIR 434