BLASTX nr result
ID: Catharanthus23_contig00019825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00019825 (741 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344998.1| PREDICTED: pentatricopeptide repeat-containi... 94 6e-17 ref|XP_004236153.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-15 gb|EMJ12275.1| hypothetical protein PRUPE_ppa017205mg, partial [... 81 4e-13 ref|XP_003601293.1| Pentatricopeptide repeat-containing protein,... 79 1e-12 ref|XP_004501962.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 gb|ESW04378.1| hypothetical protein PHAVU_011G090300g [Phaseolus... 75 2e-11 ref|XP_003540784.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-11 ref|XP_004301284.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_003634254.1| PREDICTED: pentatricopeptide repeat-containi... 72 3e-10 emb|CBI15095.3| unnamed protein product [Vitis vinifera] 72 3e-10 ref|XP_002511467.1| pentatricopeptide repeat-containing protein,... 69 1e-09 gb|EXC32244.1| hypothetical protein L484_004747 [Morus notabilis] 69 2e-09 ref|XP_006591092.1| PREDICTED: pentatricopeptide repeat-containi... 68 4e-09 ref|XP_004152457.1| PREDICTED: pentatricopeptide repeat-containi... 67 8e-09 ref|XP_002321560.2| pentatricopeptide repeat-containing family p... 65 2e-08 gb|EPS67440.1| hypothetical protein M569_07334, partial [Genlise... 65 2e-08 ref|XP_006390373.1| hypothetical protein EUTSA_v10018527mg [Eutr... 63 9e-08 ref|XP_006301673.1| hypothetical protein CARUB_v10022126mg [Caps... 62 2e-07 sp|Q9S7R4.1|PP125_ARATH RecName: Full=Pentatricopeptide repeat-c... 61 4e-07 dbj|BAD44503.1| hypothetical protein [Arabidopsis thaliana] 61 4e-07 >ref|XP_006344998.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565356286|ref|XP_006344999.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565356288|ref|XP_006345000.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 486 Score = 93.6 bits (231), Expect = 6e-17 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = +3 Query: 552 ITNLILETDPQTLSHIFHNLTEWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILSAT 731 I+NLIL++ P++LS H LT+WTPDL +LKRLWNHGPKAL FF+LLD H +Y SAT Sbjct: 38 ISNLILQSSPESLSDTLHTLTQWTPDLVQAVLKRLWNHGPKALHFFNLLDHHRSYTHSAT 97 Query: 732 AFD 740 AFD Sbjct: 98 AFD 100 >ref|XP_004236153.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Solanum lycopersicum] Length = 492 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/63 (60%), Positives = 49/63 (77%) Frame = +3 Query: 552 ITNLILETDPQTLSHIFHNLTEWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILSAT 731 I+ LIL++ P++LS H LT+WTPDL ++LKRLWNHGPKAL+FF+LLD H +Y S Sbjct: 44 ISTLILQSSPESLSDTLHTLTQWTPDLVQSVLKRLWNHGPKALQFFNLLDHHRSYTHSTI 103 Query: 732 AFD 740 AFD Sbjct: 104 AFD 106 >gb|EMJ12275.1| hypothetical protein PRUPE_ppa017205mg, partial [Prunus persica] Length = 403 Score = 80.9 bits (198), Expect = 4e-13 Identities = 37/64 (57%), Positives = 47/64 (73%), Gaps = 1/64 (1%) Frame = +3 Query: 552 ITNLILETDPQTLSHIFHN-LTEWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILSA 728 + NLIL++DPQTL+ I HN EWT DL LKRLWNHGPKA++FF +LD H +Y S Sbjct: 14 LANLILQSDPQTLTQILHNPKIEWTADLVDKTLKRLWNHGPKAIQFFKVLDHHPSYTHSR 73 Query: 729 TAFD 740 ++FD Sbjct: 74 SSFD 77 >ref|XP_003601293.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] gi|355490341|gb|AES71544.1| Pentatricopeptide repeat-containing protein, partial [Medicago truncatula] Length = 317 Score = 79.3 bits (194), Expect = 1e-12 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = +3 Query: 549 TITNLILETDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILS 725 T+ L+LE+DP+TLS N T +WTP L ILKRLWNHGPKAL+FF LDRH YI S Sbjct: 40 TVAKLVLESDPKTLSQTLSNPTFQWTPLLVDNILKRLWNHGPKALQFFKHLDRHPTYIHS 99 Query: 726 ATAFD 740 ++F+ Sbjct: 100 ISSFE 104 >ref|XP_004501962.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Cicer arietinum] Length = 498 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/65 (56%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +3 Query: 549 TITNLILETDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILS 725 TI L+LE+DP +LS NL +WTP L +LKRLWNHGPKAL+FF L+RH YI S Sbjct: 48 TIAKLVLESDPTSLSETLTNLNFQWTPHLVNNVLKRLWNHGPKALQFFKHLERHPTYIHS 107 Query: 726 ATAFD 740 +AF+ Sbjct: 108 TSAFE 112 >gb|ESW04378.1| hypothetical protein PHAVU_011G090300g [Phaseolus vulgaris] Length = 491 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/65 (55%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +3 Query: 549 TITNLILETDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILS 725 TI L+LE+DP TLS T +W P+L +LKRLWNHGPKAL+FF LDRH +YI Sbjct: 40 TIAKLVLESDPLTLSEALCMPTIQWAPELVNRVLKRLWNHGPKALQFFKHLDRHPSYIHC 99 Query: 726 ATAFD 740 +++FD Sbjct: 100 SSSFD 104 >ref|XP_003540784.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Glycine max] Length = 495 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 2/66 (3%) Frame = +3 Query: 549 TITNLILETDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHN-AYIL 722 TI L+LE+DP+T+S T +WTPDL ++KRLWNHGPKAL+FF LDRH+ +Y Sbjct: 43 TIAKLVLESDPRTVSEALTKPTIQWTPDLVNKVMKRLWNHGPKALQFFKHLDRHHPSYTH 102 Query: 723 SATAFD 740 S ++FD Sbjct: 103 SPSSFD 108 >ref|XP_004301284.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 489 Score = 72.0 bits (175), Expect = 2e-10 Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +3 Query: 561 LILETDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILSATAF 737 LIL++DPQ+L+ I H+ WTPD LKRLWNHGPKAL FF LDRH Y S++++ Sbjct: 43 LILKSDPQSLTRILHDPNIHWTPDSVNKTLKRLWNHGPKALLFFKTLDRHPTYTHSSSSY 102 Query: 738 D 740 D Sbjct: 103 D 103 >ref|XP_003634254.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Vitis vinifera] Length = 450 Score = 71.6 bits (174), Expect = 3e-10 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 549 TITNLILETDPQTLSHIFHNL-TEWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILS 725 TI NL+L+TD QTL+ EWTP+L +LK LWNHGPKAL+FF LD H Y Sbjct: 41 TIVNLVLKTDSQTLTRTLEKYPVEWTPNLVDRVLKLLWNHGPKALQFFKSLDYHPTYAHV 100 Query: 726 ATAFD 740 +++FD Sbjct: 101 SSSFD 105 >emb|CBI15095.3| unnamed protein product [Vitis vinifera] Length = 815 Score = 71.6 bits (174), Expect = 3e-10 Identities = 34/65 (52%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 549 TITNLILETDPQTLSHIFHNL-TEWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILS 725 TI NL+L+TD QTL+ EWTP+L +LK LWNHGPKAL+FF LD H Y Sbjct: 41 TIVNLVLKTDSQTLTRTLEKYPVEWTPNLVDRVLKLLWNHGPKALQFFKSLDYHPTYAHV 100 Query: 726 ATAFD 740 +++FD Sbjct: 101 SSSFD 105 >ref|XP_002511467.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550582|gb|EEF52069.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 482 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 2/66 (3%) Frame = +3 Query: 549 TITNLILE-TDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYIL 722 T+ LIL T+ QTL+ H+ + +WTP L TILKRLWNHGPKAL FF +L H +Y Sbjct: 31 TLAALILNSTNSQTLAESLHSPSIQWTPQLVNTILKRLWNHGPKALHFFKILSHHPSYCH 90 Query: 723 SATAFD 740 A++FD Sbjct: 91 QASSFD 96 >gb|EXC32244.1| hypothetical protein L484_004747 [Morus notabilis] Length = 521 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = +3 Query: 549 TITNLILETDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILS 725 + TNL+L++D +TL+ ++ WTP L ILK+LWNHGPKAL+FF LD H Y + Sbjct: 32 SFTNLVLKSDRETLTRTLNDPNLHWTPHLVDRILKKLWNHGPKALQFFKTLDYHPNYAHA 91 Query: 726 ATAFD 740 A++FD Sbjct: 92 ASSFD 96 >ref|XP_006591092.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial isoform X1 [Glycine max] gi|571489017|ref|XP_006591093.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial isoform X2 [Glycine max] Length = 492 Score = 67.8 bits (164), Expect = 4e-09 Identities = 36/66 (54%), Positives = 43/66 (65%), Gaps = 2/66 (3%) Frame = +3 Query: 549 TITNLILETDPQTLSHIFHN-LTEWTPDLACTILKRLWNHGPKALEFFSLLDRH-NAYIL 722 TI L+LE+DP+TLS WTP+L LKRLWNHGPKAL FF LDRH +Y Sbjct: 40 TIAKLVLESDPRTLSEALTKPRIHWTPELVNKTLKRLWNHGPKALLFFKHLDRHLPSYTH 99 Query: 723 SATAFD 740 S ++FD Sbjct: 100 SPSSFD 105 >ref|XP_004152457.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Cucumis sativus] gi|449487784|ref|XP_004157799.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Cucumis sativus] Length = 502 Score = 66.6 bits (161), Expect = 8e-09 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Frame = +3 Query: 552 ITNLILETDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILSA 728 I L+LE+DP++L H L ++TP+L +LKRLW HGPKAL+FF L+ H +Y SA Sbjct: 53 IATLVLESDPKSLRGSLHGLQLQFTPELVDKVLKRLWFHGPKALQFFKHLEYHPSYAHSA 112 Query: 729 TAFD 740 ++FD Sbjct: 113 SSFD 116 >ref|XP_002321560.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550322291|gb|EEF05687.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 491 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/63 (47%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = +3 Query: 555 TNLILETDPQTLSHIFHNLT-EWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILSAT 731 T ++ ++PQ L+ H+ T +WTP L TILKRLWN GPKAL+FF+LL H +Y + Sbjct: 43 TLILTSSNPQALAQTLHSPTIQWTPQLVNTILKRLWNDGPKALQFFNLLSHHPSYSHHPS 102 Query: 732 AFD 740 ++D Sbjct: 103 SYD 105 >gb|EPS67440.1| hypothetical protein M569_07334, partial [Genlisea aurea] Length = 451 Score = 65.5 bits (158), Expect = 2e-08 Identities = 34/64 (53%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +3 Query: 552 ITNLILET-DPQTLSHIFHNLTEWTPDLACTILKRLWNHGPKALEFFSLLDRHNAYILSA 728 I +LIL++ + + L H+ T+WT +LKRLWNHGPKALEFF LDRH Y SA Sbjct: 1 IGDLILQSRNREILIGTVHSRTDWTQARVQDVLKRLWNHGPKALEFFEALDRHPRYRHSA 60 Query: 729 TAFD 740 AFD Sbjct: 61 AAFD 64 >ref|XP_006390373.1| hypothetical protein EUTSA_v10018527mg [Eutrema salsugineum] gi|557086807|gb|ESQ27659.1| hypothetical protein EUTSA_v10018527mg [Eutrema salsugineum] Length = 454 Score = 63.2 bits (152), Expect = 9e-08 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +3 Query: 612 TEWTPDLACTILKRLWNHGPKALEFFSLLDRHN-AYILSATAFD 740 T WTP L ++LKRLWNHGPKAL+FF LLDRH+ Y+ A++FD Sbjct: 53 TPWTPQLVNSVLKRLWNHGPKALQFFHLLDRHHREYVHVASSFD 96 >ref|XP_006301673.1| hypothetical protein CARUB_v10022126mg [Capsella rubella] gi|482570383|gb|EOA34571.1| hypothetical protein CARUB_v10022126mg [Capsella rubella] Length = 451 Score = 62.0 bits (149), Expect = 2e-07 Identities = 32/66 (48%), Positives = 44/66 (66%), Gaps = 3/66 (4%) Frame = +3 Query: 552 ITNLILETDPQTLSHIFHNL--TEWTPDLACTILKRLWNHGPKALEFFSLLD-RHNAYIL 722 I N IL + P T+ ++ T WTP+L ++LKRLWNHGPKAL+FF LD H +Y+ Sbjct: 29 IANQILSS-PTTIDQSLVSIKTTPWTPNLVNSVLKRLWNHGPKALQFFHFLDTHHRSYVH 87 Query: 723 SATAFD 740 A++FD Sbjct: 88 HASSFD 93 >sp|Q9S7R4.1|PP125_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g74900, mitochondrial; AltName: Full=Protein ORGANELLE TRANSCRIPT PROCESSING DEFECT 43; Flags: Precursor gi|5882733|gb|AAD55286.1|AC008263_17 Contains a PF|01535 DUF17 domain [Arabidopsis thaliana] gi|12323885|gb|AAG51911.1|AC013258_5 hypothetical protein; 69434-67986 [Arabidopsis thaliana] Length = 482 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +3 Query: 612 TEWTPDLACTILKRLWNHGPKALEFFSLLDRHN-AYILSATAFD 740 T WTP+L ++LKRLWNHGPKAL+FF LD H+ Y+ A++FD Sbjct: 52 TPWTPNLVNSVLKRLWNHGPKALQFFHFLDNHHREYVHDASSFD 95 >dbj|BAD44503.1| hypothetical protein [Arabidopsis thaliana] Length = 447 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +3 Query: 612 TEWTPDLACTILKRLWNHGPKALEFFSLLDRHN-AYILSATAFD 740 T WTP+L ++LKRLWNHGPKAL+FF LD H+ Y+ A++FD Sbjct: 46 TPWTPNLVNSVLKRLWNHGPKALQFFHFLDNHHREYVHDASSFD 89