BLASTX nr result
ID: Catharanthus23_contig00019358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00019358 (223 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004253207.1| PREDICTED: uncharacterized protein At1g76070... 59 9e-07 ref|XP_006342559.1| PREDICTED: uncharacterized protein At1g76070... 58 1e-06 gb|EOY15137.1| Uncharacterized protein TCM_034301 [Theobroma cacao] 57 3e-06 emb|CBI18914.3| unnamed protein product [Vitis vinifera] 56 6e-06 emb|CAN83887.1| hypothetical protein VITISV_001638 [Vitis vinifera] 56 6e-06 >ref|XP_004253207.1| PREDICTED: uncharacterized protein At1g76070-like [Solanum lycopersicum] Length = 242 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +1 Query: 85 GSFKKPNGRKSDASAE--VSRLPDRAPGLSQMKRFASSRETLSNFDW 219 G K +GRKSD + E V +LPDRAP LSQM+RFAS RE L+NFDW Sbjct: 128 GKSKLISGRKSDVTTENIVCKLPDRAPCLSQMQRFASGREPLTNFDW 174 >ref|XP_006342559.1| PREDICTED: uncharacterized protein At1g76070-like [Solanum tuberosum] Length = 249 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/47 (61%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +1 Query: 85 GSFKKPNGRKSDASAE--VSRLPDRAPGLSQMKRFASSRETLSNFDW 219 G K +GRKSD + E + +LPDRAP LSQM+RFAS RE L+NFDW Sbjct: 130 GKSKLISGRKSDVAVENIICKLPDRAPCLSQMQRFASGREPLTNFDW 176 >gb|EOY15137.1| Uncharacterized protein TCM_034301 [Theobroma cacao] Length = 248 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 88 SFKKPNGRKSDASAEVSRLPDRAPGLSQMKRFASSRETLSNFDW 219 S KP RKS+ S++ + LPDRAP L QMKRFAS R+ SNFDW Sbjct: 131 SMAKP-ARKSETSSKKTELPDRAPSLGQMKRFASGRDAFSNFDW 173 >emb|CBI18914.3| unnamed protein product [Vitis vinifera] Length = 269 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/46 (63%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = +1 Query: 91 FKKPN-GRKSDASAEVS-RLPDRAPGLSQMKRFASSRETLSNFDWT 222 F+ N GRKSDAS++ LPDRAP L QMKRF+S R SNFDWT Sbjct: 90 FRSSNLGRKSDASSDDKPSLPDRAPSLGQMKRFSSGRNAFSNFDWT 135 >emb|CAN83887.1| hypothetical protein VITISV_001638 [Vitis vinifera] Length = 245 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +1 Query: 103 NGRKSDASAEVS-RLPDRAPGLSQMKRFASSRETLSNFDWT 222 +GRKSDAS++ LPDRAP L QMKRF+S R SNFDWT Sbjct: 133 SGRKSDASSDDKPSLPDRAPSLGQMKRFSSGRNAFSNFDWT 173