BLASTX nr result
ID: Catharanthus23_contig00019148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00019148 (449 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006479218.1| PREDICTED: SKI/DACH domain-containing protei... 62 1e-07 ref|XP_004290172.1| PREDICTED: uncharacterized protein LOC101308... 62 1e-07 ref|XP_002531087.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 ref|XP_006443545.1| hypothetical protein CICLE_v10024415mg, part... 60 4e-07 ref|XP_002303064.1| hypothetical protein POPTR_0002s24830g [Popu... 60 4e-07 ref|XP_004510247.1| PREDICTED: uncharacterized protein LOC101491... 59 9e-07 gb|EOX93827.1| Uncharacterized protein TCM_002773 [Theobroma cacao] 58 1e-06 ref|XP_002271808.2| PREDICTED: uncharacterized protein LOC100240... 58 1e-06 emb|CBI41019.3| unnamed protein product [Vitis vinifera] 58 1e-06 emb|CAN80456.1| hypothetical protein VITISV_013571 [Vitis vinifera] 58 1e-06 ref|NP_001144994.1| hypothetical protein [Zea mays] gi|195605232... 57 3e-06 ref|XP_003547785.1| PREDICTED: uncharacterized protein LOC100805... 55 7e-06 gb|ESW06136.1| hypothetical protein PHAVU_010G0228000g, partial ... 55 1e-05 ref|XP_002456835.1| hypothetical protein SORBIDRAFT_03g043770 [S... 55 1e-05 >ref|XP_006479218.1| PREDICTED: SKI/DACH domain-containing protein 1-like [Citrus sinensis] Length = 151 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 EE+DDD+P+FVLTDEWREFFAKSEAKR+LE Sbjct: 115 EEDDDDEPIFVLTDEWREFFAKSEAKRKLE 144 >ref|XP_004290172.1| PREDICTED: uncharacterized protein LOC101308138 [Fragaria vesca subsp. vesca] Length = 144 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 EEEDD+DP+FVLTDEW+EFFAKSEAKR+LE Sbjct: 106 EEEDDEDPIFVLTDEWKEFFAKSEAKRKLE 135 >ref|XP_002531087.1| conserved hypothetical protein [Ricinus communis] gi|223529333|gb|EEF31301.1| conserved hypothetical protein [Ricinus communis] Length = 73 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRL 362 E+E+DDDPVFVLTDEWREFFAKSEAKR+L Sbjct: 34 EDEEDDDPVFVLTDEWREFFAKSEAKRKL 62 >ref|XP_006443545.1| hypothetical protein CICLE_v10024415mg, partial [Citrus clementina] gi|557545807|gb|ESR56785.1| hypothetical protein CICLE_v10024415mg, partial [Citrus clementina] Length = 99 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRL 362 EE+DDD+P+FVLTDEWREFFAKSEAKR+L Sbjct: 69 EEDDDDEPIFVLTDEWREFFAKSEAKRKL 97 >ref|XP_002303064.1| hypothetical protein POPTR_0002s24830g [Populus trichocarpa] gi|222844790|gb|EEE82337.1| hypothetical protein POPTR_0002s24830g [Populus trichocarpa] Length = 150 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 EE+DDDDP+FVLTDEW+EFFA+SEA+R+LE Sbjct: 111 EEDDDDDPIFVLTDEWKEFFARSEARRKLE 140 >ref|XP_004510247.1| PREDICTED: uncharacterized protein LOC101491406 [Cicer arietinum] Length = 105 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -2 Query: 445 EEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 +E+DD+PVFVLTDEWREFFAKSEAKR+LE Sbjct: 69 DEEDDEPVFVLTDEWREFFAKSEAKRKLE 97 >gb|EOX93827.1| Uncharacterized protein TCM_002773 [Theobroma cacao] Length = 144 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -2 Query: 445 EEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 EE+D++P+FVLTDEWREFFAKSEAKR+LE Sbjct: 104 EEEDEEPIFVLTDEWREFFAKSEAKRKLE 132 >ref|XP_002271808.2| PREDICTED: uncharacterized protein LOC100240802 [Vitis vinifera] Length = 115 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 EEE+D++PVFVLTDEW EFFAKSEAKR+LE Sbjct: 76 EEEEDEEPVFVLTDEWMEFFAKSEAKRKLE 105 >emb|CBI41019.3| unnamed protein product [Vitis vinifera] Length = 135 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 EEE+D++PVFVLTDEW EFFAKSEAKR+LE Sbjct: 96 EEEEDEEPVFVLTDEWMEFFAKSEAKRKLE 125 >emb|CAN80456.1| hypothetical protein VITISV_013571 [Vitis vinifera] Length = 111 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 EEE+D++PVFVLTDEW EFFAKSEAKR+LE Sbjct: 18 EEEEDEEPVFVLTDEWMEFFAKSEAKRKLE 47 >ref|NP_001144994.1| hypothetical protein [Zea mays] gi|195605232|gb|ACG24446.1| hypothetical protein [Zea mays] gi|195649697|gb|ACG44316.1| hypothetical protein [Zea mays] gi|413951534|gb|AFW84183.1| hypothetical protein ZEAMMB73_180677 [Zea mays] Length = 146 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 448 EEEDDDDPVFVLTDEWREFFAKSEAKRRL 362 EEE+D++PVFVLTDEW EFFAKSEAKRRL Sbjct: 108 EEEEDEEPVFVLTDEWAEFFAKSEAKRRL 136 >ref|XP_003547785.1| PREDICTED: uncharacterized protein LOC100805855 [Glycine max] Length = 144 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -2 Query: 445 EEDDDDPVFVLTDEWREFFAKSEAKRRLE 359 EE++D+PVFVLTDEWREFFA+SEA+R+LE Sbjct: 107 EEEEDEPVFVLTDEWREFFAQSEARRKLE 135 >gb|ESW06136.1| hypothetical protein PHAVU_010G0228000g, partial [Phaseolus vulgaris] Length = 125 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 445 EEDDDDPVFVLTDEWREFFAKSEAKRRL 362 EE+DDDPVFVLTDEWREFFA SEA+R+L Sbjct: 98 EEEDDDPVFVLTDEWREFFAISEARRKL 125 >ref|XP_002456835.1| hypothetical protein SORBIDRAFT_03g043770 [Sorghum bicolor] gi|241928810|gb|EES01955.1| hypothetical protein SORBIDRAFT_03g043770 [Sorghum bicolor] Length = 142 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 445 EEDDDDPVFVLTDEWREFFAKSEAKRRL 362 EE+D++PVFVLTDEW EFFAKSEAKRRL Sbjct: 105 EEEDEEPVFVLTDEWAEFFAKSEAKRRL 132