BLASTX nr result
ID: Catharanthus23_contig00018965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00018965 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW81176.1| non-LTR reverse transcriptase [Arabidopsis cebenn... 51 3e-06 >gb|ABW81176.1| non-LTR reverse transcriptase [Arabidopsis cebennensis] Length = 464 Score = 51.2 bits (121), Expect(2) = 3e-06 Identities = 20/46 (43%), Positives = 34/46 (73%) Frame = +2 Query: 167 EKLDTFLKKEELVWREKSKQHWMEDGDANTHFFHLATMIQRRYNSI 304 ++ + L++EE+VW +KS++ W+ GD NT +FH +T+I+RR N I Sbjct: 296 KEFEVVLEQEEIVWFQKSREKWIALGDRNTKYFHTSTIIRRRRNQI 341 Score = 25.4 bits (54), Expect(2) = 3e-06 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 12 VLYQAETLNLKSWKKSFFGHVQTSVKDLSTEIE 110 +LY E LK W K FG++Q L EI+ Sbjct: 243 LLYSKE--KLKKWNKEVFGNIQQRKDKLVQEIQ 273