BLASTX nr result
ID: Catharanthus23_contig00018906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00018906 (461 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW16968.1| hypothetical protein PHAVU_007G199000g [Phaseolus... 58 1e-06 >gb|ESW16968.1| hypothetical protein PHAVU_007G199000g [Phaseolus vulgaris] Length = 992 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +1 Query: 52 VIEIPFDYVLILDEASLLPYQYFQIIRNFLIVVEHIGLPTCEVSKFE 192 V+E+P D V+I D A+L YQYF+ +RNFL+ VE +GLPT EVS E Sbjct: 93 VVEVPCDSVIIPDGAALSAYQYFENVRNFLVTVEEMGLPTFEVSDLE 139