BLASTX nr result
ID: Catharanthus23_contig00018639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00018639 (635 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231295.1| PREDICTED: putative high mobility group B pr... 60 7e-07 >ref|XP_004231295.1| PREDICTED: putative high mobility group B protein 11-like [Solanum lycopersicum] Length = 382 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/88 (35%), Positives = 49/88 (55%) Frame = +2 Query: 20 DKERFKKEMVIYGQICSQMTAKTQEISSNLAPSIIKFGPSSPVDNGCYVTLEASHSENFF 199 DKER+ +EM Y Q ++ T + S L PS+I FG S +D +VT + N Sbjct: 295 DKERYIREMAAYEQHKNKETTTNPNLLSGLTPSMINFGAPSVID---HVTSQGDTGSN-I 350 Query: 200 VPDETLVESTIQMLKNSRPNDPMFHINW 283 +PD + EST+Q + + ++P+F +NW Sbjct: 351 IPDASFTESTVQRPNSGKTSNPIFQMNW 378