BLASTX nr result
ID: Catharanthus23_contig00018630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00018630 (414 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808... 62 1e-07 ref|XP_006576783.1| PREDICTED: sigma factor binding protein 1, c... 59 7e-07 gb|ESW34088.1| hypothetical protein PHAVU_001G123400g [Phaseolus... 57 3e-06 gb|AFK35294.1| unknown [Medicago truncatula] 55 7e-06 ref|XP_003598460.1| Sigma factor binding protein [Medicago trunc... 55 7e-06 >ref|XP_003554126.1| PREDICTED: uncharacterized protein LOC100808231 [Glycine max] Length = 168 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 6/56 (10%) Frame = +3 Query: 207 YISNPMKVNTSASEFRALVQELTGQDSDNIPD------HDPTNKFSHIQSVGQEEE 356 YISNPMK+ TSASEFRALVQELTGQD+++ PD H P + S ++++ +EEE Sbjct: 36 YISNPMKIKTSASEFRALVQELTGQDAESPPDPSRFHGHHPDSS-SSVENIEEEEE 90 >ref|XP_006576783.1| PREDICTED: sigma factor binding protein 1, chloroplastic-like [Glycine max] Length = 167 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Frame = +3 Query: 207 YISNPMKVNTSASEFRALVQELTGQDSDNIPDHDPTNKFSH---IQSVGQEEEMKKGMEV 377 YISNPMK+ TSASEFRALVQELTGQD+++ PD + H SV EE + + Sbjct: 36 YISNPMKIKTSASEFRALVQELTGQDAESPPDPTRFHGLIHPDSSSSVDHIEEEEDNVHS 95 Query: 378 ISRTVP 395 ++ VP Sbjct: 96 VNCVVP 101 >gb|ESW34088.1| hypothetical protein PHAVU_001G123400g [Phaseolus vulgaris] Length = 149 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/69 (47%), Positives = 40/69 (57%) Frame = +3 Query: 207 YISNPMKVNTSASEFRALVQELTGQDSDNIPDHDPTNKFSHIQSVGQEEEMKKGMEVISR 386 YISNPMK+ TSASEFRALVQELTGQD+ + P +PT H + K + V Sbjct: 34 YISNPMKIKTSASEFRALVQELTGQDAQSPP--NPTR--FHALDSSDDSSSDKVISVDDH 89 Query: 387 TVPADDDDD 413 +P D D Sbjct: 90 VIPIPMDPD 98 >gb|AFK35294.1| unknown [Medicago truncatula] Length = 135 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +3 Query: 207 YISNPMKVNTSASEFRALVQELTGQDSDNIPDHDPTNKFSHIQSVGQEEE 356 YIS+PMKV TSAS FRALVQELTGQDS+ N F H+ V +++ Sbjct: 33 YISSPMKVKTSASNFRALVQELTGQDSNVADMFVEVNDFVHVDDVQNQQK 82 >ref|XP_003598460.1| Sigma factor binding protein [Medicago truncatula] gi|355487508|gb|AES68711.1| Sigma factor binding protein [Medicago truncatula] Length = 128 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +3 Query: 207 YISNPMKVNTSASEFRALVQELTGQDSDNIPDHDPTNKFSHIQSVGQEEE 356 YIS+PMKV TSAS FRALVQELTGQDS+ N F H+ V +++ Sbjct: 26 YISSPMKVKTSASNFRALVQELTGQDSNVADMFVEVNDFVHVDDVQNQQK 75