BLASTX nr result
ID: Catharanthus23_contig00018191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00018191 (658 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB55017.1| hypothetical protein L484_007348 [Morus notabilis] 53 1e-06 ref|XP_002510688.1| conserved hypothetical protein [Ricinus comm... 49 4e-06 gb|EXB56319.1| hypothetical protein L484_024861 [Morus notabilis] 53 5e-06 >gb|EXB55017.1| hypothetical protein L484_007348 [Morus notabilis] Length = 160 Score = 53.1 bits (126), Expect(2) = 1e-06 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 11/81 (13%) Frame = +1 Query: 13 GKKRKMSNDE----EFDVLKGALHTVAELIREGNSVMEMSRSHVY-------QLVVIGIE 159 GKKR D+ EF+ ++ A+ +V E IREGN++ + SR+ VY +LV IG++ Sbjct: 58 GKKRNAPGDDLFRKEFESMREAISSVTEAIREGNAIAKRSRARVYSEEEVFAELVNIGVD 117 Query: 160 SQIIDYCYIYLTQNAD*TRAF 222 ++ Y +LTQ+A RAF Sbjct: 118 ERLRYKAYTFLTQDATRVRAF 138 Score = 25.8 bits (55), Expect(2) = 1e-06 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 213 KGFFGCPSERHKYILMKLM 269 + FFGCP E K +++LM Sbjct: 136 RAFFGCPVEERKNFVLQLM 154 >ref|XP_002510688.1| conserved hypothetical protein [Ricinus communis] gi|223551389|gb|EEF52875.1| conserved hypothetical protein [Ricinus communis] Length = 321 Score = 48.5 bits (114), Expect(2) = 4e-06 Identities = 32/81 (39%), Positives = 42/81 (51%), Gaps = 11/81 (13%) Frame = +1 Query: 13 GKKRKMSNDE----EFDVLKGALHTVAELIREGNSVMEMSRSHVY-------QLVVIGIE 159 G+KRK D+ EF ++ A+ VAE IREGN + E R VY +LV IG+E Sbjct: 219 GQKRKAPKDDIFEREFKSIREAIKDVAEAIREGNIIAERGRLRVYSEQEVFTELVKIGVE 278 Query: 160 SQIIDYCYIYLTQNAD*TRAF 222 + Y +L NA RAF Sbjct: 279 RHMRYKAYTFLIANAGRARAF 299 Score = 28.5 bits (62), Expect(2) = 4e-06 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +3 Query: 213 KGFFGCPSERHKYILMKLM 269 + FFGCPSE K L+++M Sbjct: 297 RAFFGCPSEERKEFLLQMM 315 >gb|EXB56319.1| hypothetical protein L484_024861 [Morus notabilis] Length = 320 Score = 53.1 bits (126), Expect(2) = 5e-06 Identities = 34/81 (41%), Positives = 46/81 (56%), Gaps = 11/81 (13%) Frame = +1 Query: 13 GKKRKMSNDEEFD----VLKGALHTVAELIREGNSVMEMSRSHVY-------QLVVIGIE 159 GKKRK + + +F+ ++ A+ VA IREGN++ E SR HVY +LV IGIE Sbjct: 218 GKKRKATRNFDFERELSSVRDAIKDVAAAIREGNAIAERSRPHVYSEQEVFRELVNIGIE 277 Query: 160 SQIIDYCYIYLTQNAD*TRAF 222 Q+ Y +L NA RAF Sbjct: 278 KQLRFRAYTFLIANARRVRAF 298 Score = 23.5 bits (49), Expect(2) = 5e-06 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 213 KGFFGCPSERHKYILMKLM 269 + FFGCP K L+++M Sbjct: 296 RAFFGCPVGERKEFLLQMM 314