BLASTX nr result
ID: Catharanthus23_contig00018115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00018115 (572 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246951.1| PREDICTED: U-box domain-containing protein 3... 100 4e-19 ref|XP_006351668.1| PREDICTED: U-box domain-containing protein 3... 97 2e-18 gb|EXB88383.1| U-box domain-containing protein 3 [Morus notabilis] 96 5e-18 ref|XP_006576944.1| PREDICTED: U-box domain-containing protein 3... 96 6e-18 gb|EMJ03003.1| hypothetical protein PRUPE_ppa001702mg [Prunus pe... 96 6e-18 ref|XP_004289953.1| PREDICTED: U-box domain-containing protein 3... 95 1e-17 ref|XP_002306856.1| armadillo/beta-catenin repeat family protein... 95 1e-17 ref|XP_006604492.1| PREDICTED: U-box domain-containing protein 3... 95 1e-17 gb|EOX94436.1| ARM repeat superfamily protein isoform 2 [Theobro... 95 1e-17 gb|EOX94435.1| ARM repeat superfamily protein isoform 1 [Theobro... 95 1e-17 ref|XP_003632427.1| PREDICTED: U-box domain-containing protein 3... 94 2e-17 emb|CBI37127.3| unnamed protein product [Vitis vinifera] 94 2e-17 ref|XP_002277883.1| PREDICTED: U-box domain-containing protein 3... 94 2e-17 ref|XP_004495092.1| PREDICTED: U-box domain-containing protein 3... 92 9e-17 ref|XP_004495091.1| PREDICTED: U-box domain-containing protein 3... 92 9e-17 ref|XP_002302042.1| armadillo/beta-catenin repeat family protein... 92 9e-17 ref|XP_002532036.1| ubiquitin-protein ligase, putative [Ricinus ... 92 1e-16 ref|XP_004148950.1| PREDICTED: U-box domain-containing protein 3... 91 2e-16 ref|XP_006604491.1| PREDICTED: U-box domain-containing protein 3... 90 5e-16 ref|XP_006604490.1| PREDICTED: U-box domain-containing protein 3... 90 5e-16 >ref|XP_004246951.1| PREDICTED: U-box domain-containing protein 3-like isoform 2 [Solanum lycopersicum] Length = 744 Score = 99.8 bits (247), Expect = 4e-19 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ + KYCRLVLQEGAVPPLVALSQSG+PRAKEKAQQLLSHFR+ REGA GRGKS Sbjct: 689 LCLNSPKYCRLVLQEGAVPPLVALSQSGSPRAKEKAQQLLSHFRSQREGATGRGKS 744 >ref|XP_006351668.1| PREDICTED: U-box domain-containing protein 3-like [Solanum tuberosum] Length = 778 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ + KYCRLVLQEGAVPPLVALSQSG+PRAKEKAQQLLSHFR+ RE A GRGKS Sbjct: 723 LCLNSPKYCRLVLQEGAVPPLVALSQSGSPRAKEKAQQLLSHFRSQREAATGRGKS 778 >gb|EXB88383.1| U-box domain-containing protein 3 [Morus notabilis] Length = 807 Score = 96.3 bits (238), Expect = 5e-18 Identities = 46/56 (82%), Positives = 50/56 (89%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ N+K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR REG G+GKS Sbjct: 752 LCLHNTKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGTTGKGKS 807 >ref|XP_006576944.1| PREDICTED: U-box domain-containing protein 3-like isoform X5 [Glycine max] Length = 813 Score = 95.9 bits (237), Expect = 6e-18 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ N K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR REG G+GKS Sbjct: 758 LCLHNQKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGVKGKGKS 813 >gb|EMJ03003.1| hypothetical protein PRUPE_ppa001702mg [Prunus persica] Length = 777 Score = 95.9 bits (237), Expect = 6e-18 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGK 167 LC+ + K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR REGAMG+GK Sbjct: 723 LCLHSPKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAMGKGK 777 >ref|XP_004289953.1| PREDICTED: U-box domain-containing protein 3-like [Fragaria vesca subsp. vesca] Length = 758 Score = 95.1 bits (235), Expect = 1e-17 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGK 167 LC+ + K+C +VLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR REGAMG+GK Sbjct: 704 LCLHSPKFCTMVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAMGKGK 758 >ref|XP_002306856.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222856305|gb|EEE93852.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 748 Score = 95.1 bits (235), Expect = 1e-17 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ + K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR+ REG+ G+GKS Sbjct: 693 LCLNSPKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREGSAGKGKS 748 >ref|XP_006604492.1| PREDICTED: U-box domain-containing protein 3-like isoform X3 [Glycine max] Length = 796 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 +C+ + K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR REGA G+GKS Sbjct: 741 MCLHSQKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKS 796 >gb|EOX94436.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao] Length = 750 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ + K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR REGA G+GK+ Sbjct: 695 LCLNSPKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKT 750 >gb|EOX94435.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao] Length = 786 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ + K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR REGA G+GK+ Sbjct: 731 LCLNSPKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQREGATGKGKT 786 >ref|XP_003632427.1| PREDICTED: U-box domain-containing protein 3-like isoform 2 [Vitis vinifera] Length = 757 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LCI + K+C LVLQEGA+PPLVALSQSGTPRAKEKAQQLLSHFR REGA +GKS Sbjct: 702 LCINSPKFCTLVLQEGAIPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAAAKGKS 757 >emb|CBI37127.3| unnamed protein product [Vitis vinifera] Length = 615 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LCI + K+C LVLQEGA+PPLVALSQSGTPRAKEKAQQLLSHFR REGA +GKS Sbjct: 560 LCINSPKFCTLVLQEGAIPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAAAKGKS 615 >ref|XP_002277883.1| PREDICTED: U-box domain-containing protein 3-like isoform 1 [Vitis vinifera] Length = 764 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LCI + K+C LVLQEGA+PPLVALSQSGTPRAKEKAQQLLSHFR REGA +GKS Sbjct: 709 LCINSPKFCTLVLQEGAIPPLVALSQSGTPRAKEKAQQLLSHFRNQREGAAAKGKS 764 >ref|XP_004495092.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 [Cicer arietinum] Length = 761 Score = 92.0 bits (227), Expect = 9e-17 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ +S++C LVLQEGAVPPLVALSQSGT RAKEKAQQLLSHFR REGA G+GKS Sbjct: 706 LCLHSSRFCTLVLQEGAVPPLVALSQSGTLRAKEKAQQLLSHFRNQREGATGKGKS 761 >ref|XP_004495091.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 [Cicer arietinum] Length = 784 Score = 92.0 bits (227), Expect = 9e-17 Identities = 45/56 (80%), Positives = 50/56 (89%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ +S++C LVLQEGAVPPLVALSQSGT RAKEKAQQLLSHFR REGA G+GKS Sbjct: 729 LCLHSSRFCTLVLQEGAVPPLVALSQSGTLRAKEKAQQLLSHFRNQREGATGKGKS 784 >ref|XP_002302042.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] gi|222843768|gb|EEE81315.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa] Length = 753 Score = 92.0 bits (227), Expect = 9e-17 Identities = 43/56 (76%), Positives = 51/56 (91%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+++ K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR+ RE + G+G+S Sbjct: 698 LCLSSPKFCTLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRSQREASAGKGRS 753 >ref|XP_002532036.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223528306|gb|EEF30352.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 753 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/56 (78%), Positives = 49/56 (87%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGKS 170 LC+ + K+C VLQEGAVPPLVALSQSGT RAKEKAQQLLSHFR REG+MG+GKS Sbjct: 698 LCLNSPKFCTFVLQEGAVPPLVALSQSGTLRAKEKAQQLLSHFRNQREGSMGKGKS 753 >ref|XP_004148950.1| PREDICTED: U-box domain-containing protein 3-like [Cucumis sativus] gi|449524836|ref|XP_004169427.1| PREDICTED: U-box domain-containing protein 3-like [Cucumis sativus] Length = 775 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRTLREGAMGRGK 167 LC+ ++K+C LVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFR R+G G+GK Sbjct: 721 LCLHSNKFCILVLQEGAVPPLVALSQSGTPRAKEKAQQLLSHFRNQRDGTTGKGK 775 >ref|XP_006604491.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 [Glycine max] Length = 797 Score = 89.7 bits (221), Expect = 5e-16 Identities = 45/58 (77%), Positives = 50/58 (86%), Gaps = 2/58 (3%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEK--AQQLLSHFRTLREGAMGRGKS 170 +C+ + K+C LVLQEGAVPPLVALSQSGTPRAKEK AQQLLSHFR REGA G+GKS Sbjct: 740 MCLHSQKFCTLVLQEGAVPPLVALSQSGTPRAKEKMQAQQLLSHFRNQREGATGKGKS 797 >ref|XP_006604490.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 [Glycine max] Length = 798 Score = 89.7 bits (221), Expect = 5e-16 Identities = 45/58 (77%), Positives = 50/58 (86%), Gaps = 2/58 (3%) Frame = +3 Query: 3 LCITNSKYCRLVLQEGAVPPLVALSQSGTPRAKEK--AQQLLSHFRTLREGAMGRGKS 170 +C+ + K+C LVLQEGAVPPLVALSQSGTPRAKEK AQQLLSHFR REGA G+GKS Sbjct: 741 MCLHSQKFCTLVLQEGAVPPLVALSQSGTPRAKEKMQAQQLLSHFRNQREGATGKGKS 798