BLASTX nr result
ID: Catharanthus23_contig00017607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00017607 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525877.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002525877.1| conserved hypothetical protein [Ricinus communis] gi|223534791|gb|EEF36481.1| conserved hypothetical protein [Ricinus communis] Length = 137 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 198 TRDMIEQAKEELQILETQQPKRFNYLKLELNSFISHLESQKLFL 329 +R++I QA+E+L+ILET P RF YLKLEL SFIS LESQ+L L Sbjct: 5 SREIIVQAEEDLRILETHHPNRFEYLKLELKSFISFLESQQLLL 48