BLASTX nr result
ID: Catharanthus23_contig00016928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00016928 (480 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE48041.1| hypothetical protein [Nicotiana tomentosiformis] 67 3e-11 emb|CAJ32483.1| hypothetical protein [Nicotiana tabacum] gi|7779... 67 3e-11 ref|YP_004891645.1| unnamed protein product (chloroplast) [Nicot... 67 3e-11 gb|EPS74537.1| hypothetical protein M569_00254, partial [Genlise... 52 1e-06 >dbj|BAE48041.1| hypothetical protein [Nicotiana tomentosiformis] Length = 79 Score = 67.4 bits (163), Expect(2) = 3e-11 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +1 Query: 241 MGTMEIVNAKDFSEKGILMIHWSGWRKEPEINSSIVRSHET 363 MGT E+VNAKD EKGILMIHWSGWR EPEINS I RS ++ Sbjct: 1 MGTTELVNAKDSIEKGILMIHWSGWRNEPEINSCIRRSEKS 41 Score = 26.6 bits (57), Expect(2) = 3e-11 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 383 RVNIRPRKLSFFGLLNLDDKNQNQKCV 463 RVNIRPRKL L +K QN+ V Sbjct: 53 RVNIRPRKLFLLQNLGQYNKGQNKDLV 79 >emb|CAJ32483.1| hypothetical protein [Nicotiana tabacum] gi|77799603|dbj|BAE46692.1| hypothetical protein [Nicotiana sylvestris] Length = 79 Score = 67.4 bits (163), Expect(2) = 3e-11 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +1 Query: 241 MGTMEIVNAKDFSEKGILMIHWSGWRKEPEINSSIVRSHET 363 MGT E+VNAKD EKGILMIHWSGWR EPEINS I RS ++ Sbjct: 1 MGTTELVNAKDSIEKGILMIHWSGWRNEPEINSCIRRSEKS 41 Score = 26.6 bits (57), Expect(2) = 3e-11 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 383 RVNIRPRKLSFFGLLNLDDKNQNQKCV 463 RVNIRPRKL L +K QN+ V Sbjct: 53 RVNIRPRKLFLLQNLGQYNKGQNKDLV 79 >ref|YP_004891645.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|347453932|gb|AEO95590.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454043|gb|AEO95700.1| hypothetical protein [synthetic construct] Length = 79 Score = 67.0 bits (162), Expect(2) = 3e-11 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 241 MGTMEIVNAKDFSEKGILMIHWSGWRKEPEINSSIVRSHET 363 MGT E+VNAKD EKGILM+HWSGWR EPEINS I RS ++ Sbjct: 1 MGTTELVNAKDSIEKGILMVHWSGWRNEPEINSCIRRSEKS 41 Score = 26.6 bits (57), Expect(2) = 3e-11 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 383 RVNIRPRKLSFFGLLNLDDKNQNQKCV 463 RVNIRPRKL L +K QN+ V Sbjct: 53 RVNIRPRKLFLLQNLGQYNKGQNKDLV 79 >gb|EPS74537.1| hypothetical protein M569_00254, partial [Genlisea aurea] Length = 89 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = -2 Query: 272 SFAFTISIVPIASYLMLRSKFT--MELLMKFVLESIFSVFIGSKLLIF 135 SFAF SIVP AS LM+RS+F +L++F ESIF VFIGSKLL F Sbjct: 1 SFAFKASIVPTASSLMIRSEFANGASILIEFNHESIFLVFIGSKLLFF 48 Score = 26.2 bits (56), Expect(2) = 1e-06 Identities = 14/23 (60%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -3 Query: 82 VLMLYYTA--FYEMTYKPYILEF 20 V ML Y FYEMT +PYIL F Sbjct: 65 VFMLCYIVLFFYEMTPRPYILIF 87