BLASTX nr result
ID: Catharanthus23_contig00015887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00015887 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006419891.1| hypothetical protein CICLE_v10005979mg [Citr... 65 1e-08 ref|XP_004247371.1| PREDICTED: mavicyanin-like [Solanum lycopers... 63 5e-08 gb|EOY05634.1| Cupredoxin superfamily protein, putative [Theobro... 62 1e-07 ref|XP_004298161.1| PREDICTED: mavicyanin-like [Fragaria vesca s... 61 1e-07 ref|XP_004169987.1| PREDICTED: mavicyanin-like [Cucumis sativus] 61 1e-07 ref|XP_004140151.1| PREDICTED: mavicyanin-like [Cucumis sativus] 61 1e-07 gb|ADV57642.1| copper binding protein 7 [Gossypium hirsutum] 61 1e-07 ref|XP_002312522.2| hypothetical protein POPTR_0008s15040g [Popu... 60 2e-07 ref|XP_002281674.1| PREDICTED: mavicyanin [Vitis vinifera] gi|29... 60 2e-07 emb|CAN61765.1| hypothetical protein VITISV_025412 [Vitis vinifera] 60 2e-07 ref|XP_003592422.1| Blue copper protein [Medicago truncatula] gi... 60 3e-07 ref|XP_002314710.1| hypothetical protein POPTR_0010s10020g [Popu... 59 5e-07 ref|XP_006359909.1| PREDICTED: mavicyanin-like [Solanum tuberosum] 59 7e-07 ref|XP_002517215.1| Mavicyanin, putative [Ricinus communis] gi|2... 59 7e-07 ref|XP_004496752.1| PREDICTED: mavicyanin-like [Cicer arietinum] 59 9e-07 gb|EXC17566.1| hypothetical protein L484_012357 [Morus notabilis] 57 2e-06 ref|NP_198005.1| plastocyanin-like domain-containing protein / p... 57 2e-06 ref|XP_006590215.1| PREDICTED: mavicyanin-like [Glycine max] 57 2e-06 gb|ESW15224.1| hypothetical protein PHAVU_007G055000g [Phaseolus... 57 2e-06 ref|XP_006286572.1| hypothetical protein CARUB_v10002053mg [Caps... 57 2e-06 >ref|XP_006419891.1| hypothetical protein CICLE_v10005979mg [Citrus clementina] gi|557521764|gb|ESR33131.1| hypothetical protein CICLE_v10005979mg [Citrus clementina] Length = 190 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWTTIGN++YKQWAATKTFQ+ Sbjct: 25 AVYKVGDSAGWTTIGNIDYKQWAATKTFQV 54 >ref|XP_004247371.1| PREDICTED: mavicyanin-like [Solanum lycopersicum] Length = 183 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 219 GAVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 G VYKVG+SAGWTTIGNV+YKQWAA+KTFQ+ Sbjct: 28 GVVYKVGESAGWTTIGNVDYKQWAASKTFQV 58 >gb|EOY05634.1| Cupredoxin superfamily protein, putative [Theobroma cacao] Length = 187 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDS GWT+IGN++YKQWAATKTFQ+ Sbjct: 26 AVYKVGDSGGWTSIGNIDYKQWAATKTFQV 55 >ref|XP_004298161.1| PREDICTED: mavicyanin-like [Fragaria vesca subsp. vesca] Length = 177 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +3 Query: 228 YKVGDSAGWTTIGNVNYKQWAATKTFQI 311 YKVGDSAGWTTIGNVNYK+WAATKTF++ Sbjct: 27 YKVGDSAGWTTIGNVNYKEWAATKTFRV 54 >ref|XP_004169987.1| PREDICTED: mavicyanin-like [Cucumis sativus] Length = 179 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 219 GAVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 GAVYKVGD+AGWT IG V+YKQWAATKTFQ+ Sbjct: 27 GAVYKVGDAAGWTIIGGVDYKQWAATKTFQL 57 >ref|XP_004140151.1| PREDICTED: mavicyanin-like [Cucumis sativus] Length = 185 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 219 GAVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 GAVYKVGD+AGWT IG V+YKQWAATKTFQ+ Sbjct: 27 GAVYKVGDAAGWTIIGGVDYKQWAATKTFQL 57 >gb|ADV57642.1| copper binding protein 7 [Gossypium hirsutum] Length = 189 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWT+IGN++YKQW+ATKTFQ+ Sbjct: 28 AVYKVGDSAGWTSIGNLDYKQWSATKTFQV 57 >ref|XP_002312522.2| hypothetical protein POPTR_0008s15040g [Populus trichocarpa] gi|118482695|gb|ABK93266.1| unknown [Populus trichocarpa] gi|550333108|gb|EEE89889.2| hypothetical protein POPTR_0008s15040g [Populus trichocarpa] Length = 185 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWTTIGN +YK+W+ATKTFQ+ Sbjct: 24 AVYKVGDSAGWTTIGNFDYKKWSATKTFQV 53 >ref|XP_002281674.1| PREDICTED: mavicyanin [Vitis vinifera] gi|297737024|emb|CBI26225.3| unnamed protein product [Vitis vinifera] Length = 190 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWTTIGNV+YK+WA+TKTF + Sbjct: 25 AVYKVGDSAGWTTIGNVDYKKWASTKTFHV 54 >emb|CAN61765.1| hypothetical protein VITISV_025412 [Vitis vinifera] Length = 190 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWTTIGNV+YK+WA+TKTF + Sbjct: 25 AVYKVGDSAGWTTIGNVDYKKWASTKTFHV 54 >ref|XP_003592422.1| Blue copper protein [Medicago truncatula] gi|355481470|gb|AES62673.1| Blue copper protein [Medicago truncatula] Length = 185 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWTT+GN++YK+WAATK FQ+ Sbjct: 23 AVYKVGDSAGWTTLGNIDYKKWAATKNFQL 52 >ref|XP_002314710.1| hypothetical protein POPTR_0010s10020g [Populus trichocarpa] gi|118485573|gb|ABK94638.1| unknown [Populus trichocarpa] gi|222863750|gb|EEF00881.1| hypothetical protein POPTR_0010s10020g [Populus trichocarpa] Length = 185 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWT GN++YKQW+ATKTFQ+ Sbjct: 24 AVYKVGDSAGWTASGNIDYKQWSATKTFQV 53 >ref|XP_006359909.1| PREDICTED: mavicyanin-like [Solanum tuberosum] Length = 183 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AV+KVG+SAGWTTIGNV+YK WAATKTFQ+ Sbjct: 29 AVHKVGESAGWTTIGNVDYKLWAATKTFQV 58 >ref|XP_002517215.1| Mavicyanin, putative [Ricinus communis] gi|223543850|gb|EEF45378.1| Mavicyanin, putative [Ricinus communis] Length = 200 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 219 GAVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 G VYKVGD+ GWT+IGN++YKQWAATKTF++ Sbjct: 22 GTVYKVGDAGGWTSIGNLDYKQWAATKTFKV 52 >ref|XP_004496752.1| PREDICTED: mavicyanin-like [Cicer arietinum] Length = 187 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDS+GWTT+GN++YK+W+ATK FQI Sbjct: 23 AVYKVGDSSGWTTLGNIDYKKWSATKNFQI 52 >gb|EXC17566.1| hypothetical protein L484_012357 [Morus notabilis] Length = 187 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 219 GAVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 GAVYKVGDSAGWT IGNV+YK W+A KTF++ Sbjct: 23 GAVYKVGDSAGWTIIGNVDYKLWSAIKTFKV 53 >ref|NP_198005.1| plastocyanin-like domain-containing protein / putative mavicyanin [Arabidopsis thaliana] gi|3319353|gb|AAC26242.1| contains similarity to copper-binding proteins [Arabidopsis thaliana] gi|45752728|gb|AAS76262.1| At5g26330 [Arabidopsis thaliana] gi|51968496|dbj|BAD42940.1| copper binding protein - like, predicted GPI-anchored protein [Arabidopsis thaliana] gi|332006169|gb|AED93552.1| plastocyanin-like domain-containing protein / putative mavicyanin [Arabidopsis thaliana] Length = 187 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWTTI NV+YK WA+TKTF I Sbjct: 22 AVYKVGDSAGWTTIANVDYKLWASTKTFHI 51 >ref|XP_006590215.1| PREDICTED: mavicyanin-like [Glycine max] Length = 185 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWTT+G ++Y++WAATK FQI Sbjct: 23 AVYKVGDSAGWTTLGTIDYRKWAATKNFQI 52 >gb|ESW15224.1| hypothetical protein PHAVU_007G055000g [Phaseolus vulgaris] Length = 212 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDS+GWTT+G ++YK+WAATK FQI Sbjct: 53 AVYKVGDSSGWTTLGKIDYKKWAATKNFQI 82 >ref|XP_006286572.1| hypothetical protein CARUB_v10002053mg [Capsella rubella] gi|482555278|gb|EOA19470.1| hypothetical protein CARUB_v10002053mg [Capsella rubella] Length = 186 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 222 AVYKVGDSAGWTTIGNVNYKQWAATKTFQI 311 AVYKVGDSAGWTTI NV+YK WA+TKTF I Sbjct: 22 AVYKVGDSAGWTTIANVDYKLWASTKTFHI 51