BLASTX nr result
ID: Catharanthus23_contig00015720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00015720 (557 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60159.1| hypothetical protein VITISV_007129 [Vitis vinifera] 60 5e-07 >emb|CAN60159.1| hypothetical protein VITISV_007129 [Vitis vinifera] Length = 735 Score = 59.7 bits (143), Expect = 5e-07 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +2 Query: 311 MGKTLQSQESTI-LENGHPGCMRGLLHHFHHPKWHQVKRRLPHRRHSSPKLPTVVGDPGN 487 MGK +Q S I ++ PGCM G+L H WH K+RLP++RH + VG+PG Sbjct: 1 MGKHMQRDHSGIAFKSNDPGCMWGILQMLDHSHWHNFKKRLPYKRHCGGRHAMGVGNPGK 60 Query: 488 GLNYTSDAGEEQ 523 +N SDA E Q Sbjct: 61 NIN-ISDADEVQ 71