BLASTX nr result
ID: Catharanthus23_contig00015635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00015635 (219 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525050.1| Two-component response regulator ARR2, putat... 130 2e-28 ref|XP_006828277.1| hypothetical protein AMTR_s00023p00221340 [A... 129 3e-28 ref|XP_006340553.1| PREDICTED: two-component response regulator-... 129 4e-28 ref|XP_004237533.1| PREDICTED: two-component response regulator-... 129 4e-28 ref|XP_004169415.1| PREDICTED: two-component response regulator-... 129 4e-28 ref|XP_004142221.1| PREDICTED: two-component response regulator-... 129 4e-28 gb|EOY07699.1| Sensory transduction histidine kinase, putative i... 128 7e-28 ref|XP_002311124.1| predicted protein [Populus trichocarpa] 128 7e-28 gb|ABV53463.1| pseudo-response regulator 7 [Castanea sativa] 127 2e-27 ref|XP_004302833.1| PREDICTED: two-component response regulator-... 125 6e-27 ref|XP_002275645.2| PREDICTED: two-component response regulator-... 125 6e-27 emb|CBI25329.3| unnamed protein product [Vitis vinifera] 125 6e-27 ref|XP_002316333.1| hypothetical protein POPTR_0010s22230g [Popu... 125 6e-27 ref|XP_003558186.1| PREDICTED: two-component response regulator-... 124 1e-26 ref|XP_006485963.1| PREDICTED: two-component response regulator-... 124 1e-26 ref|XP_006485962.1| PREDICTED: two-component response regulator-... 124 1e-26 ref|XP_006485961.1| PREDICTED: two-component response regulator-... 124 1e-26 ref|XP_006436180.1| hypothetical protein CICLE_v10030911mg [Citr... 124 1e-26 ref|XP_004984809.1| PREDICTED: two-component response regulator-... 123 2e-26 ref|XP_004984808.1| PREDICTED: two-component response regulator-... 123 2e-26 >ref|XP_002525050.1| Two-component response regulator ARR2, putative [Ricinus communis] gi|223535631|gb|EEF37297.1| Two-component response regulator ARR2, putative [Ricinus communis] Length = 659 Score = 130 bits (327), Expect = 2e-28 Identities = 60/72 (83%), Positives = 68/72 (94%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NHIDL+L EV MPCLSGIGLL KIMNH+TCKNIPVIMMSS+DSM +VFKCLSKGA++FLV Sbjct: 21 NHIDLILSEVAMPCLSGIGLLCKIMNHRTCKNIPVIMMSSHDSMNVVFKCLSKGALDFLV 80 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 81 KPIRKNELKNLW 92 >ref|XP_006828277.1| hypothetical protein AMTR_s00023p00221340 [Amborella trichopoda] gi|548832924|gb|ERM95693.1| hypothetical protein AMTR_s00023p00221340 [Amborella trichopoda] Length = 784 Score = 129 bits (325), Expect = 3e-28 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NHIDLVL EV MP LSGIGLLSKIMNHKTCKNIPVIM SS+DSMG+VFKCLSKGAV+FLV Sbjct: 143 NHIDLVLTEVVMPYLSGIGLLSKIMNHKTCKNIPVIMTSSHDSMGVVFKCLSKGAVDFLV 202 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 203 KPIRKNELKNLW 214 >ref|XP_006340553.1| PREDICTED: two-component response regulator-like PRR37-like [Solanum tuberosum] Length = 783 Score = 129 bits (324), Expect = 4e-28 Identities = 61/72 (84%), Positives = 68/72 (94%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NH+DLVL EV MP LSG+GLLSKIMNHKT KN+PVIMMS+NDSMGIVFKCLSKGAV+FLV Sbjct: 138 NHVDLVLTEVAMPYLSGVGLLSKIMNHKTLKNVPVIMMSANDSMGIVFKCLSKGAVDFLV 197 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 198 KPIRKNELKNLW 209 >ref|XP_004237533.1| PREDICTED: two-component response regulator-like PRR37-like [Solanum lycopersicum] Length = 781 Score = 129 bits (324), Expect = 4e-28 Identities = 61/72 (84%), Positives = 68/72 (94%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NH+DLVL EV MP LSG+GLLSKIMNHKT KN+PVIMMS+NDSMGIVFKCLSKGAV+FLV Sbjct: 138 NHVDLVLTEVAMPFLSGVGLLSKIMNHKTLKNVPVIMMSANDSMGIVFKCLSKGAVDFLV 197 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 198 KPIRKNELKNLW 209 >ref|XP_004169415.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 794 Score = 129 bits (324), Expect = 4e-28 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NHIDLVL EV MPCLSGIGLL KIMNHKT KNIPVIMMSS+DSMG+VFKCLSKGAV+FLV Sbjct: 133 NHIDLVLTEVVMPCLSGIGLLCKIMNHKTRKNIPVIMMSSHDSMGLVFKCLSKGAVDFLV 192 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 193 KPIRKNELKNLW 204 >ref|XP_004142221.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Length = 797 Score = 129 bits (324), Expect = 4e-28 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NHIDLVL EV MPCLSGIGLL KIMNHKT KNIPVIMMSS+DSMG+VFKCLSKGAV+FLV Sbjct: 133 NHIDLVLTEVVMPCLSGIGLLCKIMNHKTRKNIPVIMMSSHDSMGLVFKCLSKGAVDFLV 192 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 193 KPIRKNELKNLW 204 >gb|EOY07699.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715803|gb|EOY07700.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] gi|508715804|gb|EOY07701.1| Sensory transduction histidine kinase, putative isoform 1 [Theobroma cacao] Length = 783 Score = 128 bits (322), Expect = 7e-28 Identities = 61/72 (84%), Positives = 69/72 (95%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NHIDLVL EV MPCLSG+GLLSKIM+HKT KN+PVIMMSS+DSMG+VFKCLSKGAV+FLV Sbjct: 132 NHIDLVLTEVVMPCLSGVGLLSKIMSHKTQKNVPVIMMSSHDSMGLVFKCLSKGAVDFLV 191 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 192 KPIRKNELKNLW 203 >ref|XP_002311124.1| predicted protein [Populus trichocarpa] Length = 711 Score = 128 bits (322), Expect = 7e-28 Identities = 61/72 (84%), Positives = 68/72 (94%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NHIDLVL EV MPCLSGIGLLSKIM+HKTC+NIPVIMMSS+DSM +VFKCLSKGAV+FLV Sbjct: 81 NHIDLVLTEVAMPCLSGIGLLSKIMSHKTCRNIPVIMMSSHDSMNVVFKCLSKGAVDFLV 140 Query: 182 EPIRKDELKNLW 217 +PIRK+ELK LW Sbjct: 141 KPIRKNELKILW 152 >gb|ABV53463.1| pseudo-response regulator 7 [Castanea sativa] Length = 784 Score = 127 bits (318), Expect = 2e-27 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = +2 Query: 5 HIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLVE 184 H+DLVL EV MPCLSGIGLLSKIM+HKTCKNIPVIMMSS DSM IVFKCLSKGAV+FL + Sbjct: 143 HVDLVLTEVVMPCLSGIGLLSKIMSHKTCKNIPVIMMSSYDSMNIVFKCLSKGAVDFLAK 202 Query: 185 PIRKDELKNLW 217 PIRK+ELKNLW Sbjct: 203 PIRKNELKNLW 213 >ref|XP_004302833.1| PREDICTED: two-component response regulator-like APRR7-like [Fragaria vesca subsp. vesca] Length = 732 Score = 125 bits (314), Expect = 6e-27 Identities = 58/72 (80%), Positives = 68/72 (94%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NH+DL+L EV MPC+SGIGLLSKIM+HK+ KN+PVIMMSS DSMG+VFKCLSKGAV+FLV Sbjct: 121 NHVDLILTEVVMPCVSGIGLLSKIMSHKSRKNVPVIMMSSQDSMGVVFKCLSKGAVDFLV 180 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 181 KPIRKNELKNLW 192 >ref|XP_002275645.2| PREDICTED: two-component response regulator-like PRR73 [Vitis vinifera] Length = 747 Score = 125 bits (314), Expect = 6e-27 Identities = 59/72 (81%), Positives = 66/72 (91%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NH+DLVL EV +P LSGIGLL KIMNHK CKNIPVIMMSS+DS+GIVFKCLSKGAV+F V Sbjct: 116 NHVDLVLAEVALPSLSGIGLLCKIMNHKACKNIPVIMMSSHDSVGIVFKCLSKGAVDFFV 175 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 176 KPIRKNELKNLW 187 >emb|CBI25329.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 125 bits (314), Expect = 6e-27 Identities = 59/72 (81%), Positives = 66/72 (91%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NH+DLVL EV +P LSGIGLL KIMNHK CKNIPVIMMSS+DS+GIVFKCLSKGAV+F V Sbjct: 138 NHVDLVLAEVALPSLSGIGLLCKIMNHKACKNIPVIMMSSHDSVGIVFKCLSKGAVDFFV 197 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 198 KPIRKNELKNLW 209 >ref|XP_002316333.1| hypothetical protein POPTR_0010s22230g [Populus trichocarpa] gi|566192157|ref|XP_002315312.2| hypothetical protein POPTR_0010s22230g [Populus trichocarpa] gi|222865373|gb|EEF02504.1| hypothetical protein POPTR_0010s22230g [Populus trichocarpa] gi|550330356|gb|EEF01483.2| hypothetical protein POPTR_0010s22230g [Populus trichocarpa] Length = 763 Score = 125 bits (314), Expect = 6e-27 Identities = 59/72 (81%), Positives = 67/72 (93%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 NHIDLVL EV MPCLSGIGLLS IM+HKTC+NIPVIMMSS+DSM +VF+CLSKGAV+FLV Sbjct: 133 NHIDLVLTEVAMPCLSGIGLLSNIMSHKTCRNIPVIMMSSHDSMNVVFRCLSKGAVDFLV 192 Query: 182 EPIRKDELKNLW 217 +PIRK+ELK LW Sbjct: 193 KPIRKNELKILW 204 >ref|XP_003558186.1| PREDICTED: two-component response regulator-like PRR73-like [Brachypodium distachyon] Length = 766 Score = 124 bits (312), Expect = 1e-26 Identities = 60/72 (83%), Positives = 65/72 (90%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 N IDLVL EV MPCLSGI LLSKIM+HK CK+IPVIMMS NDSMG VFKCLSKGAV+FLV Sbjct: 126 NRIDLVLTEVAMPCLSGISLLSKIMSHKICKDIPVIMMSKNDSMGTVFKCLSKGAVDFLV 185 Query: 182 EPIRKDELKNLW 217 +PIRK+ELKNLW Sbjct: 186 KPIRKNELKNLW 197 >ref|XP_006485963.1| PREDICTED: two-component response regulator-like PRR37-like isoform X3 [Citrus sinensis] Length = 744 Score = 124 bits (311), Expect = 1e-26 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 + IDLVL EV MPCLSGIGLL KIMNHKTCKNIPVIMMSS+DSM IVFKCLSKGAV FLV Sbjct: 141 DQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLV 200 Query: 182 EPIRKDELKNLW 217 +PIRK+EL+NLW Sbjct: 201 KPIRKNELQNLW 212 >ref|XP_006485962.1| PREDICTED: two-component response regulator-like PRR37-like isoform X2 [Citrus sinensis] Length = 748 Score = 124 bits (311), Expect = 1e-26 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 + IDLVL EV MPCLSGIGLL KIMNHKTCKNIPVIMMSS+DSM IVFKCLSKGAV FLV Sbjct: 141 DQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLV 200 Query: 182 EPIRKDELKNLW 217 +PIRK+EL+NLW Sbjct: 201 KPIRKNELQNLW 212 >ref|XP_006485961.1| PREDICTED: two-component response regulator-like PRR37-like isoform X1 [Citrus sinensis] Length = 780 Score = 124 bits (311), Expect = 1e-26 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 + IDLVL EV MPCLSGIGLL KIMNHKTCKNIPVIMMSS+DSM IVFKCLSKGAV FLV Sbjct: 141 DQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLV 200 Query: 182 EPIRKDELKNLW 217 +PIRK+EL+NLW Sbjct: 201 KPIRKNELQNLW 212 >ref|XP_006436180.1| hypothetical protein CICLE_v10030911mg [Citrus clementina] gi|557538376|gb|ESR49420.1| hypothetical protein CICLE_v10030911mg [Citrus clementina] Length = 660 Score = 124 bits (311), Expect = 1e-26 Identities = 61/72 (84%), Positives = 66/72 (91%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 + IDLVL EV MPCLSGIGLL KIMNHKTCKNIPVIMMSS+DSM IVFKCLSKGAV FLV Sbjct: 21 DQIDLVLTEVLMPCLSGIGLLRKIMNHKTCKNIPVIMMSSHDSMSIVFKCLSKGAVYFLV 80 Query: 182 EPIRKDELKNLW 217 +PIRK+EL+NLW Sbjct: 81 KPIRKNELQNLW 92 >ref|XP_004984809.1| PREDICTED: two-component response regulator-like PRR73-like isoform X7 [Setaria italica] Length = 667 Score = 123 bits (309), Expect = 2e-26 Identities = 59/72 (81%), Positives = 67/72 (93%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 N+IDLVL EV MPCLSGIGLLSKI +HK CK+IPVIMMSSNDSM +VFKCLSKGAV+FLV Sbjct: 32 NNIDLVLTEVFMPCLSGIGLLSKITSHKVCKDIPVIMMSSNDSMSMVFKCLSKGAVDFLV 91 Query: 182 EPIRKDELKNLW 217 +P+RK+ELKNLW Sbjct: 92 KPLRKNELKNLW 103 >ref|XP_004984808.1| PREDICTED: two-component response regulator-like PRR73-like isoform X6 [Setaria italica] Length = 677 Score = 123 bits (309), Expect = 2e-26 Identities = 59/72 (81%), Positives = 67/72 (93%) Frame = +2 Query: 2 NHIDLVLREVGMPCLSGIGLLSKIMNHKTCKNIPVIMMSSNDSMGIVFKCLSKGAVNFLV 181 N+IDLVL EV MPCLSGIGLLSKI +HK CK+IPVIMMSSNDSM +VFKCLSKGAV+FLV Sbjct: 42 NNIDLVLTEVFMPCLSGIGLLSKITSHKVCKDIPVIMMSSNDSMSMVFKCLSKGAVDFLV 101 Query: 182 EPIRKDELKNLW 217 +P+RK+ELKNLW Sbjct: 102 KPLRKNELKNLW 113