BLASTX nr result
ID: Catharanthus23_contig00014940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00014940 (538 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004234342.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-14 ref|XP_006351545.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_002266598.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 emb|CAN68456.1| hypothetical protein VITISV_025676 [Vitis vinifera] 81 1e-13 gb|EOY09866.1| Tetratricopeptide repeat-like superfamily protein... 61 1e-07 gb|EOY09865.1| Tetratricopeptide repeat-like superfamily protein... 61 1e-07 gb|EOY09864.1| Tetratricopeptide repeat-like superfamily protein... 61 1e-07 >ref|XP_004234342.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Solanum lycopersicum] Length = 533 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/73 (56%), Positives = 53/73 (72%), Gaps = 2/73 (2%) Frame = -3 Query: 218 LTSFRNLLEKYGKHQALVEQIHGQSTTLGLLCYQH--FACKLLNTYSKLNKPFEGQKVFN 45 +T+ + LL+K H+ L++QIH QS TLGLL H FACKLLN Y+KLNKP KVF+ Sbjct: 12 VTTLKRLLDKCINHENLIKQIHAQSITLGLLTQSHQSFACKLLNVYAKLNKPVAAHKVFD 71 Query: 44 EISKPDIVSWTSL 6 +I +PDIVSW+ L Sbjct: 72 QIPQPDIVSWSCL 84 >ref|XP_006351545.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Solanum tuberosum] Length = 533 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 2/72 (2%) Frame = -3 Query: 215 TSFRNLLEKYGKHQALVEQIHGQSTTLGLLC--YQHFACKLLNTYSKLNKPFEGQKVFNE 42 T+ + LL+K H+ L++QIH QS T G+ +Q FACKLLN Y+KLNKPF KVF++ Sbjct: 13 TTLKRLLDKCISHENLIQQIHAQSITCGIFTQFHQSFACKLLNIYAKLNKPFSAYKVFDQ 72 Query: 41 ISKPDIVSWTSL 6 I +PDIVSW+ L Sbjct: 73 IPQPDIVSWSCL 84 >ref|XP_002266598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] gi|297742795|emb|CBI35475.3| unnamed protein product [Vitis vinifera] Length = 517 Score = 81.3 bits (199), Expect = 1e-13 Identities = 42/71 (59%), Positives = 51/71 (71%), Gaps = 2/71 (2%) Frame = -3 Query: 212 SFRNLLEKYGKHQALVEQIHGQSTTLGLLCY--QHFACKLLNTYSKLNKPFEGQKVFNEI 39 +F LL+K G + L +QIHG++ TLGLLC QH ACKLLNTY++L P + QKVFN I Sbjct: 5 TFYFLLQKCGSLEKL-KQIHGKAVTLGLLCSKRQHLACKLLNTYTQLGSPVDAQKVFNHI 63 Query: 38 SKPDIVSWTSL 6 PDIVSWT L Sbjct: 64 QNPDIVSWTCL 74 >emb|CAN68456.1| hypothetical protein VITISV_025676 [Vitis vinifera] Length = 768 Score = 81.3 bits (199), Expect = 1e-13 Identities = 42/71 (59%), Positives = 51/71 (71%), Gaps = 2/71 (2%) Frame = -3 Query: 212 SFRNLLEKYGKHQALVEQIHGQSTTLGLLCY--QHFACKLLNTYSKLNKPFEGQKVFNEI 39 +F LL+K G + L +QIHG++ TLGLLC QH ACKLLNTY++L P + QKVFN I Sbjct: 256 TFYFLLQKCGSLEKL-KQIHGKAVTLGLLCSKRQHLACKLLNTYTQLGSPVDAQKVFNHI 314 Query: 38 SKPDIVSWTSL 6 PDIVSWT L Sbjct: 315 QNPDIVSWTCL 325 >gb|EOY09866.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 3 [Theobroma cacao] Length = 589 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 2/68 (2%) Frame = -3 Query: 203 NLLEKYGKHQALVEQIHGQSTTLGLLCY--QHFACKLLNTYSKLNKPFEGQKVFNEISKP 30 +LLEK + L ++IH +TTLGLL Q +CK+L TY+ LN P + + FN+I +P Sbjct: 9 SLLEKCPNLKNL-KKIHAHATTLGLLQNHNQALSCKILTTYANLNNPDDANRTFNQIQRP 67 Query: 29 DIVSWTSL 6 DIVSWT L Sbjct: 68 DIVSWTCL 75 >gb|EOY09865.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 2 [Theobroma cacao] Length = 587 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 2/68 (2%) Frame = -3 Query: 203 NLLEKYGKHQALVEQIHGQSTTLGLLCY--QHFACKLLNTYSKLNKPFEGQKVFNEISKP 30 +LLEK + L ++IH +TTLGLL Q +CK+L TY+ LN P + + FN+I +P Sbjct: 9 SLLEKCPNLKNL-KKIHAHATTLGLLQNHNQALSCKILTTYANLNNPDDANRTFNQIQRP 67 Query: 29 DIVSWTSL 6 DIVSWT L Sbjct: 68 DIVSWTCL 75 >gb|EOY09864.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 649 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 2/68 (2%) Frame = -3 Query: 203 NLLEKYGKHQALVEQIHGQSTTLGLLCY--QHFACKLLNTYSKLNKPFEGQKVFNEISKP 30 +LLEK + L ++IH +TTLGLL Q +CK+L TY+ LN P + + FN+I +P Sbjct: 9 SLLEKCPNLKNL-KKIHAHATTLGLLQNHNQALSCKILTTYANLNNPDDANRTFNQIQRP 67 Query: 29 DIVSWTSL 6 DIVSWT L Sbjct: 68 DIVSWTCL 75