BLASTX nr result
ID: Catharanthus23_contig00014668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00014668 (290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001051262.1| Os03g0747800 [Oryza sativa Japonica Group] g... 59 7e-07 ref|XP_006650579.1| PREDICTED: cysteine synthase-like isoform X1... 59 9e-07 gb|EOY11151.1| Cysteine synthase isoform 1 [Theobroma cacao] gi|... 59 9e-07 gb|AGF95120.1| O-acetylserine acetyltransferase [Prunus persica]... 59 9e-07 ref|XP_006433058.1| hypothetical protein CICLE_v10001835mg [Citr... 58 1e-06 ref|XP_002319618.1| predicted protein [Populus trichocarpa] gi|5... 58 1e-06 ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Viti... 58 1e-06 gb|AAQ57205.1| O-acetylserine (thiol)lyase, partial [Populus tre... 58 1e-06 gb|AAL58961.1|AC091811_10 cysteine synthase, 5'-partial [Oryza s... 58 1e-06 dbj|BAA93051.1| cysteine synthase [Allium tuberosum] 57 2e-06 ref|XP_004302011.1| PREDICTED: cysteine synthase-like [Fragaria ... 57 2e-06 ref|XP_006664222.1| PREDICTED: cysteine synthase-like [Oryza bra... 57 3e-06 gb|AAX07222.1| cysteine synthase GCS3 [Allium sativum] 57 3e-06 ref|XP_002512253.1| cysteine synthase, putative [Ricinus communi... 56 4e-06 ref|NP_001105469.1| cysteine synthase precursor [Zea mays] gi|28... 56 6e-06 ref|XP_004963252.1| PREDICTED: cysteine synthase-like isoform X3... 56 6e-06 tpg|DAA47613.1| TPA: hypothetical protein ZEAMMB73_019937 [Zea m... 56 6e-06 tpg|DAA47611.1| TPA: hypothetical protein ZEAMMB73_019937 [Zea m... 56 6e-06 gb|ACN29139.1| unknown [Zea mays] gi|414869055|tpg|DAA47612.1| T... 56 6e-06 gb|ACL54626.1| unknown [Zea mays] gi|224031241|gb|ACN34696.1| un... 56 6e-06 >ref|NP_001051262.1| Os03g0747800 [Oryza sativa Japonica Group] gi|11131901|sp|Q9XEA8.1|CYSK2_ORYSJ RecName: Full=Cysteine synthase; Short=CSase; AltName: Full=O-acetylserine (thiol)-lyase; Short=OAS-TL; AltName: Full=O-acetylserine sulfhydrylase gi|4574139|gb|AAD23909.1|AF073697_1 cysteine synthase [Oryza sativa Japonica Group] gi|14626273|gb|AAK71541.1|AC087852_1 cysteine synthase [Oryza sativa Japonica Group] gi|108711067|gb|ABF98862.1| Cysteine synthase, putative, expressed [Oryza sativa Japonica Group] gi|108711069|gb|ABF98864.1| Cysteine synthase, putative, expressed [Oryza sativa Japonica Group] gi|113549733|dbj|BAF13176.1| Os03g0747800 [Oryza sativa Japonica Group] Length = 325 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+K+EAENM+FEP Sbjct: 295 VVVFPSFGERYLSSVLFESIKREAENMVFEP 325 >ref|XP_006650579.1| PREDICTED: cysteine synthase-like isoform X1 [Oryza brachyantha] gi|573926089|ref|XP_006650580.1| PREDICTED: cysteine synthase-like isoform X2 [Oryza brachyantha] gi|573926091|ref|XP_006650581.1| PREDICTED: cysteine synthase-like isoform X3 [Oryza brachyantha] Length = 325 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+K+EAENM+FEP Sbjct: 295 VVVFPSFGERYLSSVLFDSIKREAENMVFEP 325 >gb|EOY11151.1| Cysteine synthase isoform 1 [Theobroma cacao] gi|508719255|gb|EOY11152.1| Cysteine synthase isoform 1 [Theobroma cacao] Length = 324 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+K+EAENM+FEP Sbjct: 294 VVVFPSFGERYLSSVLFESVKREAENMVFEP 324 >gb|AGF95120.1| O-acetylserine acetyltransferase [Prunus persica] gi|462401190|gb|EMJ06747.1| hypothetical protein PRUPE_ppa008600mg [Prunus persica] gi|462401191|gb|EMJ06748.1| hypothetical protein PRUPE_ppa008600mg [Prunus persica] Length = 325 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+K+EAENM+FEP Sbjct: 295 VVVFPSFGERYLSSVLFESVKREAENMVFEP 325 >ref|XP_006433058.1| hypothetical protein CICLE_v10001835mg [Citrus clementina] gi|568835359|ref|XP_006471739.1| PREDICTED: cysteine synthase-like [Citrus sinensis] gi|557535180|gb|ESR46298.1| hypothetical protein CICLE_v10001835mg [Citrus clementina] Length = 325 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+KKEAE+M+FEP Sbjct: 295 VVVFPSFGERYLSSVLFESVKKEAESMVFEP 325 >ref|XP_002319618.1| predicted protein [Populus trichocarpa] gi|566259518|ref|XP_006389317.1| O-acetylserine (thiol)lyase family protein [Populus trichocarpa] gi|566259520|ref|XP_006389318.1| hypothetical protein POPTR_0030s00390g [Populus trichocarpa] gi|118482627|gb|ABK93233.1| unknown [Populus trichocarpa] gi|550312077|gb|ERP48231.1| O-acetylserine (thiol)lyase family protein [Populus trichocarpa] gi|550312078|gb|ERP48232.1| hypothetical protein POPTR_0030s00390g [Populus trichocarpa] Length = 325 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 V +FPSFGERYLSSVLF S+KKEAENM+FEP Sbjct: 295 VAIFPSFGERYLSSVLFESVKKEAENMVFEP 325 >ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Vitis vinifera] gi|225451237|ref|XP_002275940.1| PREDICTED: cysteine synthase isoform 1 [Vitis vinifera] gi|359487829|ref|XP_003633658.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|147819267|emb|CAN75607.1| hypothetical protein VITISV_033255 [Vitis vinifera] gi|298204909|emb|CBI34216.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+K+EAENM+FEP Sbjct: 295 VVVFPSFGERYLSSVLFDSVKREAENMLFEP 325 >gb|AAQ57205.1| O-acetylserine (thiol)lyase, partial [Populus tremula x Populus alba] Length = 292 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 V +FPSFGERYLSSVLF S+KKEAENM+FEP Sbjct: 262 VAIFPSFGERYLSSVLFESVKKEAENMVFEP 292 >gb|AAL58961.1|AC091811_10 cysteine synthase, 5'-partial [Oryza sativa Japonica Group] Length = 282 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 +VVFPSFGERYLSSVLF S+K+EAENM+FEP Sbjct: 252 LVVFPSFGERYLSSVLFESIKREAENMVFEP 282 >dbj|BAA93051.1| cysteine synthase [Allium tuberosum] Length = 325 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLS+VLF S+KKEAE+M+FEP Sbjct: 295 VVVFPSFGERYLSTVLFQSIKKEAESMVFEP 325 >ref|XP_004302011.1| PREDICTED: cysteine synthase-like [Fragaria vesca subsp. vesca] Length = 325 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 V VFPSFGERYLSSVLF S+K+EAENM+FEP Sbjct: 295 VAVFPSFGERYLSSVLFESVKREAENMVFEP 325 >ref|XP_006664222.1| PREDICTED: cysteine synthase-like [Oryza brachyantha] Length = 325 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF ++KKEAENM+ EP Sbjct: 295 VVVFPSFGERYLSSVLFQTIKKEAENMVVEP 325 >gb|AAX07222.1| cysteine synthase GCS3 [Allium sativum] Length = 323 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFE 200 VVVFPSFGERYLSSVLF S+KKEAENMI+E Sbjct: 293 VVVFPSFGERYLSSVLFESIKKEAENMIYE 322 >ref|XP_002512253.1| cysteine synthase, putative [Ricinus communis] gi|223548214|gb|EEF49705.1| cysteine synthase, putative [Ricinus communis] Length = 325 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VV+FPSFGERYLSSVLF S+K+EAE+M+FEP Sbjct: 295 VVIFPSFGERYLSSVLFESVKREAESMVFEP 325 >ref|NP_001105469.1| cysteine synthase precursor [Zea mays] gi|2829688|sp|P80608.2|CYSK_MAIZE RecName: Full=Cysteine synthase; Short=CSase; AltName: Full=O-acetylserine (thiol)-lyase; Short=OAS-TL; AltName: Full=O-acetylserine sulfhydrylase gi|758353|emb|CAA59798.1| O-acetylserine (thiol) lyase [Zea mays] Length = 325 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+KKEAE+M+ EP Sbjct: 295 VVVFPSFGERYLSSVLFQSIKKEAESMVVEP 325 >ref|XP_004963252.1| PREDICTED: cysteine synthase-like isoform X3 [Setaria italica] Length = 326 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+KKEAE+M+ EP Sbjct: 296 VVVFPSFGERYLSSVLFQSIKKEAESMVVEP 326 >tpg|DAA47613.1| TPA: hypothetical protein ZEAMMB73_019937 [Zea mays] Length = 270 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+KKEAE+M+ EP Sbjct: 240 VVVFPSFGERYLSSVLFQSIKKEAESMVVEP 270 >tpg|DAA47611.1| TPA: hypothetical protein ZEAMMB73_019937 [Zea mays] Length = 313 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+KKEAE+M+ EP Sbjct: 283 VVVFPSFGERYLSSVLFQSIKKEAESMVVEP 313 >gb|ACN29139.1| unknown [Zea mays] gi|414869055|tpg|DAA47612.1| TPA: hypothetical protein ZEAMMB73_019937 [Zea mays] Length = 284 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+KKEAE+M+ EP Sbjct: 254 VVVFPSFGERYLSSVLFQSIKKEAESMVVEP 284 >gb|ACL54626.1| unknown [Zea mays] gi|224031241|gb|ACN34696.1| unknown [Zea mays] gi|414869050|tpg|DAA47607.1| TPA: cysteine synthase isoform 1 [Zea mays] gi|414869051|tpg|DAA47608.1| TPA: cysteine synthase isoform 2 [Zea mays] gi|414869052|tpg|DAA47609.1| TPA: cysteine synthase isoform 3 [Zea mays] Length = 325 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 289 VVVFPSFGERYLSSVLFYSLKKEAENMIFEP 197 VVVFPSFGERYLSSVLF S+KKEAE+M+ EP Sbjct: 295 VVVFPSFGERYLSSVLFQSIKKEAESMVVEP 325