BLASTX nr result
ID: Catharanthus23_contig00014534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00014534 (602 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68651.1| hypothetical protein M569_06117, partial [Genlise... 86 6e-15 ref|XP_006419302.1| hypothetical protein CICLE_v10004231mg [Citr... 86 1e-14 gb|EOY06823.1| Ubiquitin protein ligase 6 isoform 4 [Theobroma c... 86 1e-14 gb|EOY06821.1| Ubiquitin protein ligase 6 isoform 2 [Theobroma c... 86 1e-14 gb|EOY06820.1| Ubiquitin protein ligase 6 isoform 1 [Theobroma c... 86 1e-14 ref|XP_006337992.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 85 1e-14 ref|XP_004229032.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 85 1e-14 ref|XP_004486523.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 85 2e-14 ref|XP_003631937.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 85 2e-14 ref|XP_003631936.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 85 2e-14 gb|ESW19391.1| hypothetical protein PHAVU_006G120900g [Phaseolus... 84 3e-14 ref|XP_003594658.1| E3 ubiquitin-protein ligase UPL6 [Medicago t... 84 4e-14 gb|EMJ26597.1| hypothetical protein PRUPE_ppa000674mg [Prunus pe... 83 7e-14 ref|XP_004157028.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 83 7e-14 ref|XP_003529499.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 82 1e-13 ref|XP_002312309.2| hypothetical protein POPTR_0008s10070g [Popu... 82 1e-13 ref|XP_003550723.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 81 3e-13 ref|XP_002314972.1| hypothetical protein POPTR_0010s15980g [Popu... 80 3e-13 ref|XP_004295041.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 80 6e-13 ref|XP_006597688.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-... 77 3e-12 >gb|EPS68651.1| hypothetical protein M569_06117, partial [Genlisea aurea] Length = 100 Score = 86.3 bits (212), Expect = 6e-15 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AG AS+ ALD+LPT ATC NLLKLPPY+SKEQMEQKLLYAIN+A GFDLS Sbjct: 49 RTAGEASDQALDRLPTAATCMNLLKLPPYKSKEQMEQKLLYAINSAPGFDLS 100 >ref|XP_006419302.1| hypothetical protein CICLE_v10004231mg [Citrus clementina] gi|568871225|ref|XP_006488791.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Citrus sinensis] gi|557521175|gb|ESR32542.1| hypothetical protein CICLE_v10004231mg [Citrus clementina] Length = 1028 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AG+ASE ALD+LPT ATC NLLKLPPYRSKEQM KLLYAINA GFDLS Sbjct: 977 RAAGSASEEALDRLPTSATCMNLLKLPPYRSKEQMSTKLLYAINAEAGFDLS 1028 >gb|EOY06823.1| Ubiquitin protein ligase 6 isoform 4 [Theobroma cacao] Length = 861 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AG ASE ALD+LPT ATC NLLKLPPYRSKEQ+E KLLYAINA GFDLS Sbjct: 810 RAAGTASEEALDRLPTSATCMNLLKLPPYRSKEQLETKLLYAINADAGFDLS 861 >gb|EOY06821.1| Ubiquitin protein ligase 6 isoform 2 [Theobroma cacao] Length = 1036 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AG ASE ALD+LPT ATC NLLKLPPYRSKEQ+E KLLYAINA GFDLS Sbjct: 985 RAAGTASEEALDRLPTSATCMNLLKLPPYRSKEQLETKLLYAINADAGFDLS 1036 >gb|EOY06820.1| Ubiquitin protein ligase 6 isoform 1 [Theobroma cacao] Length = 1035 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AG ASE ALD+LPT ATC NLLKLPPYRSKEQ+E KLLYAINA GFDLS Sbjct: 984 RAAGTASEEALDRLPTSATCMNLLKLPPYRSKEQLETKLLYAINADAGFDLS 1035 >ref|XP_006337992.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Solanum tuberosum] Length = 1030 Score = 85.1 bits (209), Expect = 1e-14 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R G+AS+ ALD+LPT ATC NLLK PPYRSKEQMEQKLLYAINA GFDLS Sbjct: 979 RAGGHASDEALDRLPTSATCMNLLKFPPYRSKEQMEQKLLYAINADAGFDLS 1030 >ref|XP_004229032.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Solanum lycopersicum] Length = 1039 Score = 85.1 bits (209), Expect = 1e-14 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R G+AS+ ALD+LPT ATC NLLK PPYRSKEQMEQKLLYAINA GFDLS Sbjct: 988 RAGGHASDEALDRLPTSATCMNLLKFPPYRSKEQMEQKLLYAINADAGFDLS 1039 >ref|XP_004486523.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Cicer arietinum] Length = 1024 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/52 (78%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R GNASE ALD+LPT ATC NLLKLPPY+SKEQ+E KLLYAINA GFDLS Sbjct: 973 RAGGNASEDALDRLPTSATCMNLLKLPPYKSKEQLETKLLYAINADAGFDLS 1024 >ref|XP_003631937.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform 2 [Vitis vinifera] Length = 1016 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AG+ASE ALD+LPT ATC NLLKLPPYRSKEQM KLLYAINA GFDLS Sbjct: 965 RAAGSASEEALDRLPTSATCMNLLKLPPYRSKEQMATKLLYAINADAGFDLS 1016 >ref|XP_003631936.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform 1 [Vitis vinifera] gi|296083205|emb|CBI22841.3| unnamed protein product [Vitis vinifera] Length = 1034 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/52 (80%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AG+ASE ALD+LPT ATC NLLKLPPYRSKEQM KLLYAINA GFDLS Sbjct: 983 RAAGSASEEALDRLPTSATCMNLLKLPPYRSKEQMATKLLYAINADAGFDLS 1034 >gb|ESW19391.1| hypothetical protein PHAVU_006G120900g [Phaseolus vulgaris] Length = 1031 Score = 84.0 bits (206), Expect = 3e-14 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R GN+SE ALD+LPT ATC NLLKLPPY+SKEQ+E KLLYAINA GFDLS Sbjct: 980 RAGGNSSEEALDRLPTSATCMNLLKLPPYKSKEQLETKLLYAINADAGFDLS 1031 >ref|XP_003594658.1| E3 ubiquitin-protein ligase UPL6 [Medicago truncatula] gi|355483706|gb|AES64909.1| E3 ubiquitin-protein ligase UPL6 [Medicago truncatula] Length = 1103 Score = 83.6 bits (205), Expect = 4e-14 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R GNA+E ALD+LPT ATC NLLKLPPYRSK+QME KLLYAIN+ GFDLS Sbjct: 1052 RAGGNATEDALDRLPTAATCMNLLKLPPYRSKDQMESKLLYAINSDAGFDLS 1103 >gb|EMJ26597.1| hypothetical protein PRUPE_ppa000674mg [Prunus persica] Length = 1039 Score = 82.8 bits (203), Expect = 7e-14 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R GNASE ALD+LPT ATC NLLKLPPYRSKEQ+E KL+YAI+A GFDLS Sbjct: 988 RAGGNASEGALDRLPTAATCMNLLKLPPYRSKEQLETKLMYAISADAGFDLS 1039 >ref|XP_004157028.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Cucumis sativus] Length = 135 Score = 82.8 bits (203), Expect = 7e-14 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AGNA+E ALD+LPT ATC NLLKLPPYRSKEQ+ KLLYAI+A GFDLS Sbjct: 84 RAAGNANEEALDRLPTSATCMNLLKLPPYRSKEQLANKLLYAISADAGFDLS 135 >ref|XP_003529499.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform 1 [Glycine max] Length = 1026 Score = 82.0 bits (201), Expect = 1e-13 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R +GNA+E +LD+LPT ATC NLLKLPPY SKEQ+E KLLYAINA GFDLS Sbjct: 975 RASGNAAEESLDRLPTSATCMNLLKLPPYTSKEQLETKLLYAINADAGFDLS 1026 >ref|XP_002312309.2| hypothetical protein POPTR_0008s10070g [Populus trichocarpa] gi|550332767|gb|EEE89676.2| hypothetical protein POPTR_0008s10070g [Populus trichocarpa] Length = 1033 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/52 (76%), Positives = 42/52 (80%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R G ASE ALD+LPT ATC NLLKLPPYRSKEQ+ KLLYAINA GFDLS Sbjct: 982 RAGGTASEEALDRLPTSATCMNLLKLPPYRSKEQLATKLLYAINADAGFDLS 1033 >ref|XP_003550723.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoformX1 [Glycine max] Length = 1026 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/52 (75%), Positives = 43/52 (82%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R +GNA E +LD+LPT ATC NLLKLPPY SKEQ+E KLLYAINA GFDLS Sbjct: 975 RASGNAVEESLDRLPTSATCMNLLKLPPYTSKEQLETKLLYAINADAGFDLS 1026 >ref|XP_002314972.1| hypothetical protein POPTR_0010s15980g [Populus trichocarpa] gi|222864012|gb|EEF01143.1| hypothetical protein POPTR_0010s15980g [Populus trichocarpa] Length = 1027 Score = 80.5 bits (197), Expect = 3e-13 Identities = 39/52 (75%), Positives = 42/52 (80%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R G ASE ALD+LPT ATC NLLKLPPYRSKEQ+ KLLY+INA GFDLS Sbjct: 976 RAGGTASEEALDRLPTSATCMNLLKLPPYRSKEQLATKLLYSINADAGFDLS 1027 >ref|XP_004295041.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like [Fragaria vesca subsp. vesca] Length = 1035 Score = 79.7 bits (195), Expect = 6e-13 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R AG+A++ ALD+LPT ATC NLLKLPPYRSKEQ+E KL+YAI++ GFDLS Sbjct: 984 RAAGSATDEALDRLPTAATCMNLLKLPPYRSKEQLETKLMYAISSEAGFDLS 1035 >ref|XP_006597688.1| PREDICTED: E3 ubiquitin-protein ligase UPL6-like isoform X3 [Glycine max] Length = 993 Score = 77.4 bits (189), Expect = 3e-12 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = +1 Query: 1 RGAGNASEVALDQLPTEATCTNLLKLPPYRSKEQMEQKLLYAINAATGFDLS 156 R N + ALD+LPT ATC NLLKLPPY+SKEQ+E KLLYAINA GFDLS Sbjct: 942 RAGSNDPDEALDRLPTSATCMNLLKLPPYKSKEQLETKLLYAINADAGFDLS 993