BLASTX nr result
ID: Catharanthus23_contig00014429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00014429 (459 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006451277.1| hypothetical protein CICLE_v10008880mg [Citr... 66 4e-09 ref|XP_002283720.1| PREDICTED: probable iron/ascorbate oxidoredu... 65 7e-09 ref|XP_002283713.1| PREDICTED: probable iron/ascorbate oxidoredu... 65 7e-09 ref|XP_002283708.1| PREDICTED: probable iron/ascorbate oxidoredu... 65 7e-09 emb|CBI28008.3| unnamed protein product [Vitis vinifera] 65 7e-09 gb|EOY15728.1| Hyoscyamine 6-dioxygenase, putative isoform 3 [Th... 64 2e-08 gb|EOY15726.1| Hyoscyamine 6-dioxygenase, putative isoform 1 [Th... 64 2e-08 ref|XP_002325020.2| hypothetical protein POPTR_0018s09390g [Popu... 64 3e-08 ref|XP_006853673.1| hypothetical protein AMTR_s00056p00122020 [A... 63 5e-08 gb|ESW24905.1| hypothetical protein PHAVU_004G170700g [Phaseolus... 62 6e-08 ref|XP_006599127.1| PREDICTED: probable iron/ascorbate oxidoredu... 62 8e-08 ref|XP_006475560.1| PREDICTED: probable iron/ascorbate oxidoredu... 62 1e-07 ref|XP_006451276.1| hypothetical protein CICLE_v10008865mg [Citr... 62 1e-07 gb|AFK41389.1| unknown [Lotus japonicus] 62 1e-07 ref|XP_002961098.1| hypothetical protein SELMODRAFT_402706 [Sela... 62 1e-07 ref|XP_002966911.1| hypothetical protein SELMODRAFT_408167 [Sela... 62 1e-07 ref|XP_006478443.1| PREDICTED: flavonol synthase/flavanone 3-hyd... 61 1e-07 ref|XP_006478438.1| PREDICTED: flavonol synthase/flavanone 3-hyd... 61 1e-07 gb|EPS58400.1| oxidoreductase, partial [Genlisea aurea] 61 1e-07 ref|XP_004503479.1| PREDICTED: probable iron/ascorbate oxidoredu... 61 1e-07 >ref|XP_006451277.1| hypothetical protein CICLE_v10008880mg [Citrus clementina] gi|568843319|ref|XP_006475561.1| PREDICTED: probable iron/ascorbate oxidoreductase DDB_G0283291-like [Citrus sinensis] gi|557554503|gb|ESR64517.1| hypothetical protein CICLE_v10008880mg [Citrus clementina] Length = 333 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D VVECLPTC+S NPPKFPPVK G YL QRY THA L Sbjct: 289 HDCVVECLPTCKSEKNPPKFPPVKYGSYLSQRYKDTHADL 328 >ref|XP_002283720.1| PREDICTED: probable iron/ascorbate oxidoreductase DDB_G0283291-like isoform 3 [Vitis vinifera] Length = 307 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPPVK G YL QRY THA L Sbjct: 260 HDCLVECLPTCKSDKNPPKFPPVKCGTYLTQRYKDTHADL 299 >ref|XP_002283713.1| PREDICTED: probable iron/ascorbate oxidoreductase DDB_G0283291-like isoform 2 [Vitis vinifera] Length = 358 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPPVK G YL QRY THA L Sbjct: 311 HDCLVECLPTCKSDKNPPKFPPVKCGTYLTQRYKDTHADL 350 >ref|XP_002283708.1| PREDICTED: probable iron/ascorbate oxidoreductase DDB_G0283291-like isoform 1 [Vitis vinifera] Length = 364 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPPVK G YL QRY THA L Sbjct: 317 HDCLVECLPTCKSDKNPPKFPPVKCGTYLTQRYKDTHADL 356 >emb|CBI28008.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPPVK G YL QRY THA L Sbjct: 283 HDCLVECLPTCKSDKNPPKFPPVKCGTYLTQRYKDTHADL 322 >gb|EOY15728.1| Hyoscyamine 6-dioxygenase, putative isoform 3 [Theobroma cacao] Length = 338 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPP++ G YL QRY THA L Sbjct: 291 HDCLVECLPTCKSEKNPPKFPPIRCGTYLTQRYKDTHAEL 330 >gb|EOY15726.1| Hyoscyamine 6-dioxygenase, putative isoform 1 [Theobroma cacao] gi|508723830|gb|EOY15727.1| Hyoscyamine 6-dioxygenase, putative isoform 1 [Theobroma cacao] Length = 337 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPP++ G YL QRY THA L Sbjct: 290 HDCLVECLPTCKSEKNPPKFPPIRCGTYLTQRYKDTHAEL 329 >ref|XP_002325020.2| hypothetical protein POPTR_0018s09390g [Populus trichocarpa] gi|550318388|gb|EEF03585.2| hypothetical protein POPTR_0018s09390g [Populus trichocarpa] Length = 341 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 YD +VECLPTC+S NPPKFPPV GDYL QRY TH L Sbjct: 294 YDCLVECLPTCKSEKNPPKFPPVIYGDYLGQRYKDTHIDL 333 >ref|XP_006853673.1| hypothetical protein AMTR_s00056p00122020 [Amborella trichopoda] gi|548857334|gb|ERN15140.1| hypothetical protein AMTR_s00056p00122020 [Amborella trichopoda] Length = 326 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPK+PP+KS YL QRY THA L Sbjct: 279 HDCIVECLPTCKSDSNPPKYPPIKSEAYLHQRYMDTHADL 318 >gb|ESW24905.1| hypothetical protein PHAVU_004G170700g [Phaseolus vulgaris] Length = 330 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPP+ DYL QRY THA L Sbjct: 283 HDCLVECLPTCKSDSNPPKFPPILCQDYLTQRYEDTHADL 322 >ref|XP_006599127.1| PREDICTED: probable iron/ascorbate oxidoreductase DDB_G0283291-like isoform X2 [Glycine max] Length = 330 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPP+ DYL QRY THA L Sbjct: 283 HDCLVECLPTCKSDSNPPKFPPILCHDYLTQRYNDTHADL 322 >ref|XP_006475560.1| PREDICTED: probable iron/ascorbate oxidoreductase DDB_G0283291-like isoform X2 [Citrus sinensis] Length = 281 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPP+K YL QRY THA L Sbjct: 234 HDCLVECLPTCKSDKNPPKFPPIKCETYLSQRYKDTHADL 273 >ref|XP_006451276.1| hypothetical protein CICLE_v10008865mg [Citrus clementina] gi|568843315|ref|XP_006475559.1| PREDICTED: probable iron/ascorbate oxidoreductase DDB_G0283291-like isoform X1 [Citrus sinensis] gi|557554502|gb|ESR64516.1| hypothetical protein CICLE_v10008865mg [Citrus clementina] Length = 336 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPP+K YL QRY THA L Sbjct: 289 HDCLVECLPTCKSDKNPPKFPPIKCETYLSQRYKDTHADL 328 >gb|AFK41389.1| unknown [Lotus japonicus] Length = 82 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPP+ DYL QRY THA L Sbjct: 35 HDCLVECLPTCKSDSNPPKFPPILCRDYLSQRYNDTHADL 74 >ref|XP_002961098.1| hypothetical protein SELMODRAFT_402706 [Selaginella moellendorffii] gi|300172037|gb|EFJ38637.1| hypothetical protein SELMODRAFT_402706 [Selaginella moellendorffii] Length = 342 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC S NPPK+PP+KSGD+L RY TH L Sbjct: 290 FDCIVECLPTCCSPSNPPKYPPIKSGDHLTYRYQITHKGL 329 >ref|XP_002966911.1| hypothetical protein SELMODRAFT_408167 [Selaginella moellendorffii] gi|300164902|gb|EFJ31510.1| hypothetical protein SELMODRAFT_408167 [Selaginella moellendorffii] Length = 342 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC S NPPK+PP+KSGD+L RY TH L Sbjct: 290 FDCIVECLPTCCSPSNPPKYPPIKSGDHLTYRYQITHKGL 329 >ref|XP_006478443.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Citrus sinensis] Length = 147 Score = 61.2 bits (147), Expect = 1e-07 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRY 101 +DYV+ECLPTC+S DNPPK+P +K+GDY+L R+ Sbjct: 101 HDYVIECLPTCKSEDNPPKYPTIKTGDYILSRF 133 >ref|XP_006478438.1| PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Citrus sinensis] Length = 147 Score = 61.2 bits (147), Expect = 1e-07 Identities = 22/33 (66%), Positives = 30/33 (90%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRY 101 +DYV+ECLPTC+S DNPPK+P +K+GDY+L R+ Sbjct: 101 HDYVIECLPTCKSEDNPPKYPTIKTGDYILSRF 133 >gb|EPS58400.1| oxidoreductase, partial [Genlisea aurea] Length = 87 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTCQS DNPPKF P++ DY+L++Y TH L Sbjct: 44 HDCIVECLPTCQSEDNPPKFTPIRCEDYVLRKYEETHNKL 83 >ref|XP_004503479.1| PREDICTED: probable iron/ascorbate oxidoreductase DDB_G0283291-like isoform X1 [Cicer arietinum] Length = 329 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +3 Query: 3 YDYVVECLPTCQSTDNPPKFPPVKSGDYLLQRYASTHASL 122 +D +VECLPTC+S NPPKFPP+ DYL QRY THA+L Sbjct: 282 HDCLVECLPTCKSDANPPKFPPIYYRDYLSQRYKETHANL 321