BLASTX nr result
ID: Catharanthus23_contig00014269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00014269 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267590.1| PREDICTED: uncharacterized protein LOC100243... 60 4e-07 >ref|XP_002267590.1| PREDICTED: uncharacterized protein LOC100243390 [Vitis vinifera] Length = 301 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/72 (52%), Positives = 48/72 (66%), Gaps = 6/72 (8%) Frame = -2 Query: 307 KKGPILAASSYPSSITLREELSGRKVK-----SVSAKSMLKLDHNKTIALWAGQ-ASIP* 146 +KG L ++S+ +SITLREE SGRK S + KSMLKL H K++A+WA Q ASIP Sbjct: 8 RKGSGLPSASH-TSITLREENSGRKQNKAKGGSTNMKSMLKLQHLKSLAMWASQEASIPS 66 Query: 145 VGAFVGHWYGPC 110 +GAF GH C Sbjct: 67 LGAFFGHRLMSC 78