BLASTX nr result
ID: Catharanthus23_contig00014125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00014125 (724 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) ... 85 2e-14 ref|YP_008993263.1| hypothetical chloroplast RF34 (chloroplast) ... 85 2e-14 ref|YP_008994480.1| hypothetical chloroplast RF34 (chloroplast) ... 85 2e-14 ref|YP_008963481.1| hypothetical chloroplast RF34 (chloroplast) ... 85 2e-14 gb|AFK81300.1| hypothetical chloroplast RF34 [Camellia sinensis ... 85 2e-14 ref|YP_008963606.1| photosystem I assembly protein Ycf3 (chlorop... 85 2e-14 ref|YP_008814857.1| hypothetical chloroplast RF21 (chloroplast) ... 85 2e-14 gb|AGW96677.1| hypothetical chloroplast RF34 (chloroplast) [Argy... 85 2e-14 ref|YP_008592640.1| photosystem I assembly protein ycf3 (chlorop... 85 2e-14 ref|YP_008081266.1| hypothetical chloroplast RF34 (chloroplast) ... 85 2e-14 ref|YP_007317249.1| photosystem I assembly protein Ycf3 (chlorop... 85 2e-14 gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] 85 2e-14 ref|NP_084670.3| photosystem I assembly protein Ycf3 [Oenothera ... 85 2e-14 ref|YP_086967.1| photosystem I assembly protein Ycf3 [Panax gins... 85 2e-14 gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chl... 85 2e-14 ref|YP_003359360.2| photosystem I assembly protein Ycf3 (chlorop... 85 2e-14 ref|YP_004769813.1| hypothetical chloroplast RF34 (chloroplast) ... 85 2e-14 ref|YP_004072463.1| Ycf3 protein [Corynocarpus laevigata] gi|309... 85 2e-14 ref|YP_004021151.1| hypothetical chloroplast RF34 [Castanea moll... 85 2e-14 gb|ADD30875.1| putative RF3 protein [Plumbago auriculata] 85 2e-14 >ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|576312302|ref|YP_009000186.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] gi|555944022|gb|AGZ17926.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|555944275|gb|AGZ18176.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_008993263.1| hypothetical chloroplast RF34 (chloroplast) [Magnolia dealbata] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_008994480.1| hypothetical chloroplast RF34 (chloroplast) [Hypseocharis bilobata] gi|540067559|gb|AGV02910.1| hypothetical chloroplast RF34 (chloroplast) [Hypseocharis bilobata] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_008963481.1| hypothetical chloroplast RF34 (chloroplast) [Penthorum chinense] gi|403226782|gb|AFR25661.1| hypothetical chloroplast RF34 (chloroplast) [Penthorum chinense] Length = 169 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >gb|AFK81300.1| hypothetical chloroplast RF34 [Camellia sinensis var. assamica] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_008963606.1| photosystem I assembly protein Ycf3 (chloroplast) [Lupinus luteus] gi|485474317|gb|AGK82919.1| photosystem I assembly protein Ycf3 (chloroplast) [Lupinus luteus] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_008814857.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] gi|458599091|gb|AGG38957.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >gb|AGW96677.1| hypothetical chloroplast RF34 (chloroplast) [Argyreia nervosa] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_008592640.1| photosystem I assembly protein ycf3 (chloroplast) [Berberis bealei] gi|536462681|gb|AGU37046.1| photosystem I assembly protein ycf3 (chloroplast) [Berberis bealei] Length = 169 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_008081266.1| hypothetical chloroplast RF34 (chloroplast) [Catharanthus roseus] gi|474452077|gb|AGI51145.1| hypothetical chloroplast RF34 (chloroplast) [Catharanthus roseus] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_007317249.1| photosystem I assembly protein Ycf3 (chloroplast) [Camellia sinensis] gi|430728273|gb|AGA55597.1| photosystem I assembly protein Ycf3 (chloroplast) [Camellia sinensis] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] Length = 170 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|NP_084670.3| photosystem I assembly protein Ycf3 [Oenothera elata subsp. hookeri] gi|108802644|ref|YP_636300.1| photosystem I assembly protein Ycf3 [Eucalyptus globulus subsp. globulus] gi|169142700|ref|YP_001687127.1| photosystem I assembly protein Ycf3 [Oenothera argillicola] gi|169142850|ref|YP_001687273.1| photosystem I assembly protein Ycf3 [Oenothera glazioviana] gi|169142935|ref|YP_001687357.1| photosystem I assembly protein Ycf3 [Oenothera biennis] gi|169143021|ref|YP_001687441.1| photosystem I assembly protein Ycf3 [Oenothera parviflora] gi|309322450|ref|YP_003933963.1| hypothetical chloroplast RF34 [Eucalyptus grandis] gi|313199703|ref|YP_004021317.1| hypothetical chloroplast RF34 [Theobroma cacao] gi|501770855|ref|YP_007889862.1| hypothetical chloroplast RF34 [Francoa sonchifolia] gi|545716246|ref|YP_008575114.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus obliqua] gi|545716332|ref|YP_008575199.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus radiata] gi|545716418|ref|YP_008575284.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus delegatensis] gi|545716504|ref|YP_008575369.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus verrucata] gi|545716590|ref|YP_008575454.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus baxteri] gi|545716676|ref|YP_008575539.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus diversifolia] gi|545716762|ref|YP_008575624.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus sieberi] gi|545716848|ref|YP_008575709.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus elata] gi|545716934|ref|YP_008575794.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus regnans] gi|545717020|ref|YP_008575879.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus umbra] gi|545717106|ref|YP_008575964.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus cloeziana] gi|545717192|ref|YP_008576049.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus patens] gi|545717278|ref|YP_008576134.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus marginata] gi|545717364|ref|YP_008576219.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus curtisii] gi|545717450|ref|YP_008576304.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus melliodora] gi|545717536|ref|YP_008576389.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus polybractea] gi|545717622|ref|YP_008576474.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus cladocalyx] gi|545717708|ref|YP_008576559.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus nitens] gi|545717794|ref|YP_008576644.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus aromaphloia] gi|545717880|ref|YP_008576729.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus saligna] gi|545717966|ref|YP_008576814.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus camaldulensis] gi|545718052|ref|YP_008576899.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus deglupta] gi|545718138|ref|YP_008576984.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus spathulata] gi|545718224|ref|YP_008577069.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus torquata] gi|545718310|ref|YP_008577154.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus diversicolor] gi|545718396|ref|YP_008577239.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus salmonophloia] gi|545718482|ref|YP_008577324.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus microcorys] gi|545718568|ref|YP_008577409.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus guilfoylei] gi|545718654|ref|YP_008577494.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus erythrocorys] gi|545718740|ref|YP_008577579.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia gummifera] gi|545718826|ref|YP_008577664.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia maculata] gi|545718912|ref|YP_008577749.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia eximia] gi|545718998|ref|YP_008577834.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia tessellaris] gi|545719084|ref|YP_008577919.1| photosystem I assembly protein Ycf3 (chloroplast) [Angophora floribunda] gi|545719170|ref|YP_008578004.1| photosystem I assembly protein Ycf3 (chloroplast) [Angophora costata] gi|545719256|ref|YP_008578174.1| photosystem I assembly protein Ycf3 (chloroplast) [Stockwellia quadrifida] gi|545719428|ref|YP_008578089.1| photosystem I assembly protein Ycf3 (chloroplast) [Allosyncarpia ternata] gi|122239624|sp|Q49KZ7.1|YCF3_EUCGG RecName: Full=Photosystem I assembly protein Ycf3 gi|172045804|sp|Q9MTP0.3|YCF3_OENEH RecName: Full=Photosystem I assembly protein Ycf3 gi|60460810|gb|AAX21030.1| ycf3 protein [Eucalyptus globulus subsp. globulus] gi|159792938|gb|ABW98694.1| photosystem I assembly protein Ycf3 [Oenothera argillicola] gi|159793108|gb|ABW98862.1| photosystem I assembly protein Ycf3 [Oenothera biennis] gi|159895462|gb|ABX10027.1| photosystem I assembly protein Ycf3 [Oenothera glazioviana] gi|159895547|gb|ABX10111.1| photosystem I assembly protein Ycf3 [Oenothera parviflora] gi|162423677|emb|CAB67135.2| photosystem I assembly protein Ycf3 [Oenothera elata subsp. hookeri] gi|290488970|gb|ADD30869.1| putative RF3 protein [Euonymus americanus] gi|308223284|gb|ADO23592.1| hypothetical chloroplast RF34 [Eucalyptus grandis] gi|309321267|gb|ADO64810.1| hypothetical chloroplast RF34 [Theobroma cacao] gi|328924784|gb|ADO64891.2| hypothetical chloroplast R34 [Theobroma cacao] gi|371925937|gb|AEX57727.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926019|gb|AEX57808.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926101|gb|AEX57889.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926183|gb|AEX57970.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926265|gb|AEX58051.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926347|gb|AEX58132.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926429|gb|AEX58213.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926511|gb|AEX58294.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926593|gb|AEX58375.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|371926675|gb|AEX58456.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma grandiflorum] gi|371926757|gb|AEX58537.1| hypothetical chloroplast RF34 (chloroplast) [Theobroma cacao] gi|386268366|gb|AFJ00472.1| hypothetical chloroplast RF34 [Francoa sonchifolia] gi|442566154|gb|AGC56353.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus obliqua] gi|442566240|gb|AGC56438.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus radiata] gi|442566326|gb|AGC56523.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus delegatensis] gi|442566412|gb|AGC56608.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus verrucata] gi|442566498|gb|AGC56693.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus baxteri] gi|442566584|gb|AGC56778.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus diversifolia] gi|442566670|gb|AGC56863.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus sieberi] gi|442566756|gb|AGC56948.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus elata] gi|442566842|gb|AGC57033.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus regnans] gi|442566928|gb|AGC57118.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus umbra] gi|442567014|gb|AGC57203.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus cloeziana] gi|442567100|gb|AGC57288.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus patens] gi|442567186|gb|AGC57373.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus marginata] gi|442567272|gb|AGC57458.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus curtisii] gi|442567358|gb|AGC57543.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus melliodora] gi|442567444|gb|AGC57628.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus melliodora] gi|442567530|gb|AGC57713.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus polybractea] gi|442567616|gb|AGC57798.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus cladocalyx] gi|442567702|gb|AGC57883.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus globulus] gi|442567788|gb|AGC57968.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus nitens] gi|442567874|gb|AGC58053.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus aromaphloia] gi|442567960|gb|AGC58138.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus saligna] gi|442568046|gb|AGC58223.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus camaldulensis] gi|442568132|gb|AGC58308.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus deglupta] gi|442568218|gb|AGC58393.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus spathulata] gi|442568304|gb|AGC58478.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus torquata] gi|442568390|gb|AGC58563.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus diversicolor] gi|442568476|gb|AGC58648.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus salmonophloia] gi|442568562|gb|AGC58733.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus microcorys] gi|442568648|gb|AGC58818.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus guilfoylei] gi|442568734|gb|AGC58903.1| photosystem I assembly protein Ycf3 (chloroplast) [Eucalyptus erythrocorys] gi|442568820|gb|AGC58988.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia gummifera] gi|442568906|gb|AGC59073.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia maculata] gi|442568992|gb|AGC59158.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia eximia] gi|442569078|gb|AGC59243.1| photosystem I assembly protein Ycf3 (chloroplast) [Corymbia tessellaris] gi|442569164|gb|AGC59328.1| photosystem I assembly protein Ycf3 (chloroplast) [Angophora floribunda] gi|442569250|gb|AGC59413.1| photosystem I assembly protein Ycf3 (chloroplast) [Angophora costata] gi|442569336|gb|AGC59498.1| photosystem I assembly protein Ycf3 (chloroplast) [Allosyncarpia ternata] gi|442569422|gb|AGC59583.1| photosystem I assembly protein Ycf3 (chloroplast) [Stockwellia quadrifida] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_086967.1| photosystem I assembly protein Ycf3 [Panax ginseng] gi|359422145|ref|YP_004935553.1| photosystem I assembly protein Ycf3 (chloroplast) [Eleutherococcus senticosus] gi|558602913|ref|YP_008814944.1| hypothetical chloroplast RF34 (chloroplast) [Brassaiopsis hainla] gi|558603001|ref|YP_008815031.1| hypothetical chloroplast RF34 (chloroplast) [Metapanax delavayi] gi|558603089|ref|YP_008815118.1| hypothetical chloroplast RF34 (chloroplast) [Schefflera delavayi] gi|563940386|ref|YP_008815205.1| hypothetical chloroplast RF34 (chloroplast) [Kalopanax septemlobus] gi|68053100|sp|Q68S05.1|YCF3_PANGI RecName: Full=Photosystem I assembly protein Ycf3 gi|51235314|gb|AAT98510.1| ycf3 protein [Panax ginseng] gi|347448208|gb|AEO92620.1| photosystem I assembly protein Ycf3 (chloroplast) [Eleutherococcus senticosus] gi|458599193|gb|AGG39044.1| hypothetical chloroplast RF34 (chloroplast) [Brassaiopsis hainla] gi|458599372|gb|AGG39131.1| hypothetical chloroplast RF34 (chloroplast) [Metapanax delavayi] gi|458599525|gb|AGG39218.1| hypothetical chloroplast RF34 (chloroplast) [Schefflera delavayi] gi|458599613|gb|AGG39305.1| hypothetical chloroplast RF34 (chloroplast) [Kalopanax septemlobus] gi|506444474|gb|AGM15036.1| photosystem I assembly protein Ycf3 (chloroplast) [Panax ginseng] gi|506444562|gb|AGM15122.1| photosystem I assembly protein Ycf3 (chloroplast) [Panax ginseng] gi|506444678|gb|AGM15208.1| photosystem I assembly protein Ycf3 (chloroplast) [Panax ginseng] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chloroplast) [Mollugo verticillata] Length = 217 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_003359360.2| photosystem I assembly protein Ycf3 (chloroplast) [Olea europaea] gi|363413086|gb|ADA69927.2| photosystem I assembly protein Ycf3 (chloroplast) [Olea europaea] Length = 167 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_004769813.1| hypothetical chloroplast RF34 (chloroplast) [Wolffiella lingulata] gi|341834156|gb|AEK94426.1| hypothetical chloroplast RF34 [Wolffiella lingulata] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_004072463.1| Ycf3 protein [Corynocarpus laevigata] gi|309252891|gb|ADO60311.1| Ycf3 protein [Corynocarpus laevigata] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >ref|YP_004021151.1| hypothetical chloroplast RF34 [Castanea mollissima] gi|443267308|ref|YP_007375044.1| hypothetical chloroplast RF34 [Quercus rubra] gi|290488984|gb|ADD30876.1| putative RF3 protein [Quercus nigra] gi|309321521|gb|ADO65061.1| hypothetical chloroplast RF34 [Castanea mollissima] gi|441421923|gb|AGC31247.1| hypothetical chloroplast RF34 [Quercus rubra] Length = 168 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41 >gb|ADD30875.1| putative RF3 protein [Plumbago auriculata] Length = 171 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 600 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 722 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRD 41