BLASTX nr result
ID: Catharanthus23_contig00012457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00012457 (289 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB31257.1| hypothetical protein L484_014741 [Morus notabilis] 47 5e-06 >gb|EXB31257.1| hypothetical protein L484_014741 [Morus notabilis] Length = 283 Score = 47.0 bits (110), Expect(2) = 5e-06 Identities = 21/32 (65%), Positives = 26/32 (81%) Frame = +1 Query: 43 FQIFSSFMARITKFEELVDAGNRYLIGF*QGL 138 F IF FMAR+T+F+ELVD G+R L+GF QGL Sbjct: 82 FTIFKEFMARVTEFDELVDFGSRLLVGFHQGL 113 Score = 28.9 bits (63), Expect(2) = 5e-06 Identities = 10/20 (50%), Positives = 18/20 (90%) Frame = +3 Query: 228 LEFIQRAPIDMTAELIERIV 287 LEF++++PID T+EL++ I+ Sbjct: 113 LEFLRKSPIDKTSELVKNII 132