BLASTX nr result
ID: Catharanthus23_contig00011806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00011806 (685 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB44941.1| Chaperonin 60 subunit beta 4 [Morus notabilis] 71 3e-10 >gb|EXB44941.1| Chaperonin 60 subunit beta 4 [Morus notabilis] Length = 649 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -2 Query: 516 MGVTLQLMMDLFVAGFSLMIGLGLFAFIASILCSAAFLQNAKELS 382 MG ++Q ++DL VAGFSLMIGLG+FAFIAS+LCSAAFLQNAK+ S Sbjct: 605 MGFSVQSILDLVVAGFSLMIGLGIFAFIASVLCSAAFLQNAKDAS 649