BLASTX nr result
ID: Catharanthus23_contig00011424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00011424 (840 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||A05190 hypothetical protein 77 - common tobacco chloroplast... 63 1e-07 >pir||A05190 hypothetical protein 77 - common tobacco chloroplast gi|225199|prf||1211235AD ORF 77 Length = 77 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 6 NGQFSPVGIGSSIPSLRTVLESFLPHTAQQLIPLALRFNRFYL 134 NG FSP GIGSSIPSLRTVLE+FLPHTAQQ I L F+ +++ Sbjct: 35 NGLFSPAGIGSSIPSLRTVLENFLPHTAQQSILLVSHFDLYHI 77