BLASTX nr result
ID: Catharanthus23_contig00011409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00011409 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY02834.1| Uncharacterized protein TCM_017237 [Theobroma cacao] 57 3e-06 >gb|EOY02834.1| Uncharacterized protein TCM_017237 [Theobroma cacao] Length = 113 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = +1 Query: 274 EIKREKDKER---MNTDWGPVVVAVAMFILLSPGLLFQL 381 E+K+E+ KER M+ DWGPV+VAV +FILLSPGLLFQL Sbjct: 31 ELKKERGKERKREMSADWGPVIVAVVLFILLSPGLLFQL 69