BLASTX nr result
ID: Catharanthus23_contig00010585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00010585 (240 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489566.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 58 1e-06 ref|XP_006420181.1| hypothetical protein CICLE_v10005008mg [Citr... 58 1e-06 ref|XP_006493816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 55 7e-06 ref|XP_006420908.1| hypothetical protein CICLE_v10005201mg [Citr... 55 7e-06 ref|XP_006420907.1| hypothetical protein CICLE_v10005201mg [Citr... 55 7e-06 ref|XP_002529299.1| Desacetoxyvindoline 4-hydroxylase, putative ... 55 1e-05 ref|XP_002317688.1| hypothetical protein POPTR_0011s15970g [Popu... 55 1e-05 >ref|XP_006489566.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Citrus sinensis] Length = 367 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 148 DWRKIELKAFDDTRKGVKGIVDSGNKKIPRIFIHEKNE 35 D RK EL+AFDD++ GVKG+VDSG K+PRIFIHE+N+ Sbjct: 8 DDRKSELEAFDDSKTGVKGLVDSGAAKVPRIFIHEQNK 45 >ref|XP_006420181.1| hypothetical protein CICLE_v10005008mg [Citrus clementina] gi|557522054|gb|ESR33421.1| hypothetical protein CICLE_v10005008mg [Citrus clementina] Length = 432 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 148 DWRKIELKAFDDTRKGVKGIVDSGNKKIPRIFIHEKNE 35 D RK EL+AFDD++ GVKG+VDSG K+PRIFIHE+N+ Sbjct: 73 DDRKSELEAFDDSKTGVKGLVDSGAAKVPRIFIHEQNK 110 >ref|XP_006493816.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Citrus sinensis] Length = 372 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 142 RKIELKAFDDTRKGVKGIVDSGNKKIPRIFIHEK 41 RK ELKAFDDT+ GVKG+VD+G KIPRIFIH++ Sbjct: 19 RKSELKAFDDTKAGVKGLVDAGITKIPRIFIHDQ 52 >ref|XP_006420908.1| hypothetical protein CICLE_v10005201mg [Citrus clementina] gi|557522781|gb|ESR34148.1| hypothetical protein CICLE_v10005201mg [Citrus clementina] Length = 290 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 142 RKIELKAFDDTRKGVKGIVDSGNKKIPRIFIHEK 41 RK ELKAFDDT+ GVKG+VD+G KIPRIFIH++ Sbjct: 19 RKSELKAFDDTKAGVKGLVDAGITKIPRIFIHDQ 52 >ref|XP_006420907.1| hypothetical protein CICLE_v10005201mg [Citrus clementina] gi|557522780|gb|ESR34147.1| hypothetical protein CICLE_v10005201mg [Citrus clementina] Length = 372 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 142 RKIELKAFDDTRKGVKGIVDSGNKKIPRIFIHEK 41 RK ELKAFDDT+ GVKG+VD+G KIPRIFIH++ Sbjct: 19 RKSELKAFDDTKAGVKGLVDAGITKIPRIFIHDQ 52 >ref|XP_002529299.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] gi|223531223|gb|EEF33068.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] Length = 652 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 142 RKIELKAFDDTRKGVKGIVDSGNKKIPRIFIHEK 41 RK ELK FDDT+ GVKG+VD+G KIPRIFIH+K Sbjct: 16 RKSELKIFDDTKAGVKGLVDAGVTKIPRIFIHDK 49 >ref|XP_002317688.1| hypothetical protein POPTR_0011s15970g [Populus trichocarpa] gi|222860753|gb|EEE98300.1| hypothetical protein POPTR_0011s15970g [Populus trichocarpa] Length = 368 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/43 (51%), Positives = 34/43 (79%) Frame = -3 Query: 142 RKIELKAFDDTRKGVKGIVDSGNKKIPRIFIHEKNEPIAEKSN 14 ++ +LKAFDDTR GVKG++D+G KIP+IF+H+K ++ S+ Sbjct: 16 KESQLKAFDDTRTGVKGLIDNGITKIPKIFVHDKRSDVSSDSD 58