BLASTX nr result
ID: Catharanthus23_contig00010546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00010546 (613 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006488823.1| PREDICTED: flowering time control protein FC... 60 6e-07 >ref|XP_006488823.1| PREDICTED: flowering time control protein FCA-like [Citrus sinensis] Length = 700 Score = 59.7 bits (143), Expect = 6e-07 Identities = 27/46 (58%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Frame = -1 Query: 613 RGSQTVQELSYTKLP-AAAGPINDQTHLQQGPTPGQDWMWKNRPSG 479 RG QEL YT+LP AAG +N+ T QQG QDWMWKN+PSG Sbjct: 654 RGQHNAQELGYTQLPPVAAGSVNNPTRFQQGLQAAQDWMWKNKPSG 699