BLASTX nr result
ID: Catharanthus23_contig00010039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00010039 (465 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW26036.1| hypothetical protein PHAVU_003G086300g [Phaseolus... 70 2e-10 ref|NP_001235946.1| uncharacterized protein LOC547653 [Glycine m... 70 2e-10 ref|XP_004236656.1| PREDICTED: uncharacterized protein LOC101257... 67 2e-09 ref|XP_006350257.1| PREDICTED: neurofilament heavy polypeptide-l... 67 3e-09 ref|XP_004507598.1| PREDICTED: pollen-specific leucine-rich repe... 67 3e-09 ref|XP_004239815.1| PREDICTED: uncharacterized protein LOC101246... 67 3e-09 gb|AFK36989.1| unknown [Medicago truncatula] 66 4e-09 gb|AFK35490.1| unknown [Medicago truncatula] 66 4e-09 ref|XP_003610595.1| Proline-rich protein [Medicago truncatula] g... 66 4e-09 ref|XP_004250293.1| PREDICTED: IgA FC receptor-like isoform 2 [S... 65 9e-09 ref|XP_004250292.1| PREDICTED: IgA FC receptor-like isoform 1 [S... 65 9e-09 gb|ABM05953.1| proline-rich protein [Gossypium hirsutum] 65 9e-09 ref|XP_006365842.1| PREDICTED: pollen-specific leucine-rich repe... 65 1e-08 ref|XP_006414360.1| hypothetical protein EUTSA_v10026065mg [Eutr... 64 2e-08 ref|XP_006284371.1| hypothetical protein CARUB_v10005542mg [Caps... 64 2e-08 ref|XP_002870162.1| hypothetical protein ARALYDRAFT_493247 [Arab... 64 2e-08 ref|NP_974559.5| metal ion binding protein [Arabidopsis thaliana... 64 2e-08 gb|AAL38281.1| unknown protein [Arabidopsis thaliana] gi|2014872... 64 2e-08 ref|XP_004486344.1| PREDICTED: pollen-specific leucine-rich repe... 63 5e-08 ref|XP_006352451.1| PREDICTED: uncharacterized protein LOC102600... 62 6e-08 >gb|ESW26036.1| hypothetical protein PHAVU_003G086300g [Phaseolus vulgaris] Length = 248 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 350 MAEKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 MAEKVT M+L+VDLQC CYKKVKKILCKFPQIRDQVY Sbjct: 1 MAEKVTIMRLKVDLQCHKCYKKVKKILCKFPQIRDQVY 38 >ref|NP_001235946.1| uncharacterized protein LOC547653 [Glycine max] gi|22597168|gb|AAN03471.1| unknown protein [Glycine max] Length = 240 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +2 Query: 350 MAEKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 MAEKVT M+L+VDLQC CYKKVKKILCKFPQIRDQVY Sbjct: 1 MAEKVTIMRLKVDLQCHKCYKKVKKILCKFPQIRDQVY 38 >ref|XP_004236656.1| PREDICTED: uncharacterized protein LOC101257948 [Solanum lycopersicum] Length = 266 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EK T M L+VDLQCPCCYKK KKILCK PQ+RDQ+Y Sbjct: 7 EKTTVMVLKVDLQCPCCYKKAKKILCKMPQVRDQMY 42 >ref|XP_006350257.1| PREDICTED: neurofilament heavy polypeptide-like [Solanum tuberosum] Length = 260 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EK T M L+VDLQCPCCYKK KKILCK PQ+RDQ+Y Sbjct: 7 EKTTIMVLKVDLQCPCCYKKAKKILCKMPQVRDQMY 42 >ref|XP_004507598.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1-like isoform X1 [Cicer arietinum] gi|502149614|ref|XP_004507599.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1-like isoform X2 [Cicer arietinum] Length = 252 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/40 (82%), Positives = 35/40 (87%), Gaps = 2/40 (5%) Frame = +2 Query: 350 MAEKV--TEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 MAEKV T MKL+VDLQC CYKKVKK+LCKFPQIRDQVY Sbjct: 1 MAEKVKVTIMKLKVDLQCDKCYKKVKKVLCKFPQIRDQVY 40 >ref|XP_004239815.1| PREDICTED: uncharacterized protein LOC101246249 [Solanum lycopersicum] Length = 326 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EK+T M L+VDLQC CYKKVKKILCKFPQIRDQVY Sbjct: 7 EKITIMMLKVDLQCSSCYKKVKKILCKFPQIRDQVY 42 >gb|AFK36989.1| unknown [Medicago truncatula] Length = 209 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 359 KVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 KVT MKL+VDLQC CYKKVKK+LCKFPQIRDQVY Sbjct: 8 KVTIMKLKVDLQCAKCYKKVKKVLCKFPQIRDQVY 42 >gb|AFK35490.1| unknown [Medicago truncatula] Length = 261 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 359 KVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 KVT MKL+VDLQC CYKKVKK+LCKFPQIRDQVY Sbjct: 8 KVTIMKLKVDLQCAKCYKKVKKVLCKFPQIRDQVY 42 >ref|XP_003610595.1| Proline-rich protein [Medicago truncatula] gi|355511650|gb|AES92792.1| Proline-rich protein [Medicago truncatula] Length = 261 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 359 KVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 KVT MKL+VDLQC CYKKVKK+LCKFPQIRDQVY Sbjct: 8 KVTIMKLKVDLQCAKCYKKVKKVLCKFPQIRDQVY 42 >ref|XP_004250293.1| PREDICTED: IgA FC receptor-like isoform 2 [Solanum lycopersicum] Length = 262 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EK T M L+VDLQC CYKKVKKILCKFPQIRDQVY Sbjct: 4 EKTTIMVLKVDLQCSSCYKKVKKILCKFPQIRDQVY 39 >ref|XP_004250292.1| PREDICTED: IgA FC receptor-like isoform 1 [Solanum lycopersicum] Length = 296 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EK T M L+VDLQC CYKKVKKILCKFPQIRDQVY Sbjct: 4 EKTTIMVLKVDLQCSSCYKKVKKILCKFPQIRDQVY 39 >gb|ABM05953.1| proline-rich protein [Gossypium hirsutum] Length = 182 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 350 MAEKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 M EKVT M L+VDLQC CYKKVK++LCKFPQIRDQ+Y Sbjct: 1 MGEKVTIMVLKVDLQCRRCYKKVKQVLCKFPQIRDQIY 38 >ref|XP_006365842.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1-like [Solanum tuberosum] Length = 327 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EK+T M L+VDLQC CYKKVKKILCKFPQIRDQ Y Sbjct: 7 EKITIMLLKVDLQCSSCYKKVKKILCKFPQIRDQTY 42 >ref|XP_006414360.1| hypothetical protein EUTSA_v10026065mg [Eutrema salsugineum] gi|557115530|gb|ESQ55813.1| hypothetical protein EUTSA_v10026065mg [Eutrema salsugineum] Length = 251 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EKVT MKL+VDL C CYKKVKK+LCKFPQIRDQ++ Sbjct: 7 EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLF 42 >ref|XP_006284371.1| hypothetical protein CARUB_v10005542mg [Capsella rubella] gi|482553076|gb|EOA17269.1| hypothetical protein CARUB_v10005542mg [Capsella rubella] Length = 257 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EKVT MKL+VDL C CYKKVKK+LCKFPQIRDQ++ Sbjct: 7 EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLF 42 >ref|XP_002870162.1| hypothetical protein ARALYDRAFT_493247 [Arabidopsis lyrata subsp. lyrata] gi|297315998|gb|EFH46421.1| hypothetical protein ARALYDRAFT_493247 [Arabidopsis lyrata subsp. lyrata] Length = 244 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EKVT MKL+VDL C CYKKVKK+LCKFPQIRDQ++ Sbjct: 7 EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLF 42 >ref|NP_974559.5| metal ion binding protein [Arabidopsis thaliana] gi|332658339|gb|AEE83739.1| metal ion binding protein [Arabidopsis thaliana] Length = 254 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EKVT MKL+VDL C CYKKVKK+LCKFPQIRDQ++ Sbjct: 7 EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLF 42 >gb|AAL38281.1| unknown protein [Arabidopsis thaliana] gi|20148729|gb|AAM10255.1| unknown protein [Arabidopsis thaliana] gi|62320809|dbj|BAD93746.1| hypothetical protein [Arabidopsis thaliana] Length = 254 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EKVT MKL+VDL C CYKKVKK+LCKFPQIRDQ++ Sbjct: 7 EKVTMMKLKVDLDCAKCYKKVKKVLCKFPQIRDQLF 42 >ref|XP_004486344.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1-like [Cicer arietinum] Length = 242 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +2 Query: 350 MAEKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 MAEKVT MKL+VDL+C CYKKVKK+L K+PQIRDQ Y Sbjct: 1 MAEKVTIMKLKVDLECDKCYKKVKKLLSKYPQIRDQKY 38 >ref|XP_006352451.1| PREDICTED: uncharacterized protein LOC102600600 [Solanum tuberosum] Length = 200 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +2 Query: 356 EKVTEMKLEVDLQCPCCYKKVKKILCKFPQIRDQVY 463 EK M L+VDLQC CYKKVKKILCKFPQIRDQVY Sbjct: 4 EKTAIMVLKVDLQCSNCYKKVKKILCKFPQIRDQVY 39