BLASTX nr result
ID: Catharanthus23_contig00009732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00009732 (329 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006470124.1| PREDICTED: cytochrome P450 94A2-like [Citrus... 69 7e-10 ref|XP_006447077.1| hypothetical protein CICLE_v10017920mg [Citr... 69 7e-10 emb|CBI15656.3| unnamed protein product [Vitis vinifera] 69 9e-10 ref|XP_002279981.1| PREDICTED: cytochrome P450 94A1-like [Vitis ... 69 9e-10 ref|XP_002300103.1| cytochrome P450 family protein [Populus tric... 68 1e-09 ref|XP_006338805.1| PREDICTED: cytochrome P450 94A1-like [Solanu... 67 2e-09 gb|EXC33355.1| Cytochrome P450 94A1 [Morus notabilis] 66 6e-09 gb|EMJ16233.1| hypothetical protein PRUPE_ppa004311mg [Prunus pe... 65 1e-08 ref|XP_004233587.1| PREDICTED: cytochrome P450 94A1-like [Solanu... 65 1e-08 gb|EXB98012.1| Cytochrome P450 94A1 [Morus notabilis] 64 2e-08 ref|XP_006290939.1| hypothetical protein CARUB_v10017052mg [Caps... 64 3e-08 ref|NP_201150.1| cytochrome P450, family 94, subfamily B, polype... 64 3e-08 gb|AAM60854.1| cytochrome P450-like protein [Arabidopsis thaliana] 64 3e-08 gb|EOY22465.1| Cytochrome P450 94A2 [Theobroma cacao] 63 4e-08 ref|XP_004303976.1| PREDICTED: cytochrome P450 94A1-like [Fragar... 63 4e-08 ref|XP_002273811.2| PREDICTED: cytochrome P450 94A1 [Vitis vinif... 62 6e-08 emb|CBI21357.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|NP_190421.1| cytochrome P450, family 94, subfamily B, polype... 62 6e-08 ref|XP_006394276.1| hypothetical protein EUTSA_v10005707mg [Eutr... 61 1e-07 ref|XP_002877615.1| CYP94B3 [Arabidopsis lyrata subsp. lyrata] g... 61 1e-07 >ref|XP_006470124.1| PREDICTED: cytochrome P450 94A2-like [Citrus sinensis] Length = 497 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTM 191 MKY+VAS+L+R+QI P S PVFVP LTAHMAGG KVFVRRR+ + Sbjct: 451 MKYVVASVLRRYQIRPVRSGQPVFVPRLTAHMAGGLKVFVRRREQL 496 >ref|XP_006447077.1| hypothetical protein CICLE_v10017920mg [Citrus clementina] gi|557549688|gb|ESR60317.1| hypothetical protein CICLE_v10017920mg [Citrus clementina] Length = 492 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTM 191 MKY+VAS+L+R+QI P S PVFVP LTAHMAGG KVFVRRR+ + Sbjct: 446 MKYVVASVLRRYQIRPVRSGQPVFVPRLTAHMAGGLKVFVRRREQL 491 >emb|CBI15656.3| unnamed protein product [Vitis vinifera] Length = 247 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRR 200 MKY+VAS+L+RF+I PA S PVFVP LTAHMAGGFKV VR+R Sbjct: 199 MKYVVASILRRFEIRPAGSNRPVFVPLLTAHMAGGFKVVVRKR 241 >ref|XP_002279981.1| PREDICTED: cytochrome P450 94A1-like [Vitis vinifera] Length = 512 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRR 200 MKY+VAS+L+RF+I PA S PVFVP LTAHMAGGFKV VR+R Sbjct: 464 MKYVVASILRRFEIRPAGSNRPVFVPLLTAHMAGGFKVVVRKR 506 >ref|XP_002300103.1| cytochrome P450 family protein [Populus trichocarpa] gi|222847361|gb|EEE84908.1| cytochrome P450 family protein [Populus trichocarpa] Length = 514 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTMSSLNQNV 170 MKY++AS+L RF+I P SSA PVFVP LTAHMAGG +V V++R +S+N+ + Sbjct: 461 MKYVMASILDRFKIKPLSSASPVFVPLLTAHMAGGLEVLVQKRTQTTSINKQL 513 >ref|XP_006338805.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum] Length = 522 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTMS 188 MKY+V+S+LKRFQI PA S PVF+P LTAHMAGGFK+FV + + ++ Sbjct: 472 MKYVVSSILKRFQIRPACSDPPVFLPLLTAHMAGGFKIFVHKTKNVN 518 >gb|EXC33355.1| Cytochrome P450 94A1 [Morus notabilis] Length = 523 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTMS 188 MKY VAS+L+RF+I+P S PVFVP LTAHMAGGFKV + +R+ ++ Sbjct: 477 MKYAVASVLRRFKIIPVGSDRPVFVPLLTAHMAGGFKVSISKREVLT 523 >gb|EMJ16233.1| hypothetical protein PRUPE_ppa004311mg [Prunus persica] Length = 517 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRR-QTMSSLNQNV 170 MKY+VAS+L+RF+I P S PVFVP LTAHMAGG KV VR+R S N N+ Sbjct: 463 MKYVVASILRRFEIRPVESVEPVFVPRLTAHMAGGLKVLVRKRGDDHSDKNYNI 516 >ref|XP_004233587.1| PREDICTED: cytochrome P450 94A1-like [Solanum lycopersicum] Length = 513 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTM 191 MKY+V+S+LKRF I PASS P+F+P LTAHMAGGF +FV + + + Sbjct: 468 MKYVVSSILKRFHITPASSDPPLFLPLLTAHMAGGFNIFVHKTKNI 513 >gb|EXB98012.1| Cytochrome P450 94A1 [Morus notabilis] Length = 490 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRR 200 MKY+VAS+L RF+I P S PVFVP LTAHMAGG KV VRRR Sbjct: 446 MKYVVASVLSRFEIRPVSLNRPVFVPLLTAHMAGGLKVLVRRR 488 >ref|XP_006290939.1| hypothetical protein CARUB_v10017052mg [Capsella rubella] gi|482559646|gb|EOA23837.1| hypothetical protein CARUB_v10017052mg [Capsella rubella] Length = 506 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/53 (58%), Positives = 38/53 (71%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTMSSLNQNV 170 MKY+V S+L RF+IVP PVFVP LTAHMAGG KV ++RR + +N NV Sbjct: 456 MKYVVGSVLSRFEIVPVGKDRPVFVPLLTAHMAGGLKVKIKRRSHI--INNNV 506 >ref|NP_201150.1| cytochrome P450, family 94, subfamily B, polypeptide 1 [Arabidopsis thaliana] gi|9758286|dbj|BAB08810.1| cytochrome P450-like protein [Arabidopsis thaliana] gi|77024778|gb|ABA61323.1| cytochrome P450 CYP94B1 [Arabidopsis thaliana] gi|332010367|gb|AED97750.1| cytochrome P450, family 94, subfamily B, polypeptide 1 [Arabidopsis thaliana] Length = 510 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTMSSL 182 MKY+V S+L RF+I+P + PVFVP LTAHMAGG KV ++RR+ S+ Sbjct: 460 MKYVVGSVLSRFKIIPVCNNRPVFVPLLTAHMAGGLKVKIKRREQCDSM 508 >gb|AAM60854.1| cytochrome P450-like protein [Arabidopsis thaliana] Length = 508 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTMSSL 182 MKY+V S+L RF+I+P + PVFVP LTAHMAGG KV ++RR+ S+ Sbjct: 458 MKYVVGSVLSRFKIIPVCNNRPVFVPLLTAHMAGGLKVKIKRREQCDSM 506 >gb|EOY22465.1| Cytochrome P450 94A2 [Theobroma cacao] Length = 508 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRR 200 MKY+VAS+L+RF+I P PVFVP LTAHMAGG V VRRR Sbjct: 464 MKYVVASILRRFEIRPVCQEQPVFVPLLTAHMAGGLNVLVRRR 506 >ref|XP_004303976.1| PREDICTED: cytochrome P450 94A1-like [Fragaria vesca subsp. vesca] Length = 509 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQT 194 MKY++AS+L++F+I P S +PVFVP LTAHMAGG KV VR+R T Sbjct: 464 MKYVMASILRQFEIRPVDSDVPVFVPRLTAHMAGGMKVLVRKRGT 508 >ref|XP_002273811.2| PREDICTED: cytochrome P450 94A1 [Vitis vinifera] Length = 516 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTM 191 MKY+V S+L++F+I P PVFVP LTAHMAGG V VRRRQT+ Sbjct: 469 MKYVVGSILRQFEIRPVGLDEPVFVPLLTAHMAGGLNVSVRRRQTL 514 >emb|CBI21357.3| unnamed protein product [Vitis vinifera] Length = 538 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQTM 191 MKY+V S+L++F+I P PVFVP LTAHMAGG V VRRRQT+ Sbjct: 491 MKYVVGSILRQFEIRPVGLDEPVFVPLLTAHMAGGLNVSVRRRQTL 536 >ref|NP_190421.1| cytochrome P450, family 94, subfamily B, polypeptide 3 [Arabidopsis thaliana] gi|6523083|emb|CAB62341.1| cytochrome P450-like protein [Arabidopsis thaliana] gi|51536434|gb|AAU05455.1| At3g48520 [Arabidopsis thaliana] gi|53828589|gb|AAU94404.1| At3g48520 [Arabidopsis thaliana] gi|110740781|dbj|BAE98488.1| cytochrome P450 like protein [Arabidopsis thaliana] gi|332644905|gb|AEE78426.1| cytochrome P450, family 94, subfamily B, polypeptide 3 [Arabidopsis thaliana] Length = 506 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRR 200 MKY+V S+L RF+IVP + PVFVP LTAHMAGG KV ++RR Sbjct: 457 MKYVVGSVLSRFEIVPVNKDRPVFVPLLTAHMAGGLKVKIKRR 499 >ref|XP_006394276.1| hypothetical protein EUTSA_v10005707mg [Eutrema salsugineum] gi|557090915|gb|ESQ31562.1| hypothetical protein EUTSA_v10005707mg [Eutrema salsugineum] Length = 505 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRRQ 197 MK++V S+L RF+IVP PVFVP LTAHMAGG KV ++RR+ Sbjct: 461 MKFVVGSVLSRFKIVPVCDTRPVFVPLLTAHMAGGLKVKIKRRE 504 >ref|XP_002877615.1| CYP94B3 [Arabidopsis lyrata subsp. lyrata] gi|297323453|gb|EFH53874.1| CYP94B3 [Arabidopsis lyrata subsp. lyrata] Length = 506 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -2 Query: 328 MKYIVASLLKRFQIVPASSAMPVFVPFLTAHMAGGFKVFVRRR 200 MKY+V S+L RF+I+P + PVFVP LTAHMAGG KV ++RR Sbjct: 457 MKYVVGSVLSRFEIIPVNLDRPVFVPLLTAHMAGGLKVKIKRR 499